Allele Report for 3DL2*00202


3DL2*00202
Previous Designations & Local Names: FH08_BA2X
IPD Acc No: KIR00460
Assigned: 28-AUG-2009 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182343  
Cells Sequence Derived From: FH08  
Known Ethnic Origin Of Source: Black
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (455 aa)
MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESF
IMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHRDGI
SEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENV
TLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPS
SSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQ
LDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
Nucleotide Sequence Data (1368 bps)
ATGTCGCTCACGGTCGTCAGCATGGCGTGCGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACTCATGGGTGGTCAGGA
CAAACCCTTCCTGTCTGCCCGGCCCAGCACTGTGGTGCCTCGAGGAGGACACGTGGCTCTTCAGTGTCACTATCGTCGTG
GGTTTAACAATTTCATGCTGTACAAAGAAGACAGAAGCCACGTTCCCATCTTCCACGGCAGAATATTCCAGGAGAGCTTC
ATCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTCGGGGTTCACGCCCACACTCCCTCACTGGGTGGTC
GGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGGCCCCTGC
TGAAATCAGGAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCATGTTTGAGCACTTCTTTCTGCACAGAGATGGGATC
TCTGAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCCCTTGATGCC
TGTCCTTGCAGGAACCTACAGATGTTATGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCCCTGG
ACATCGTGATCACAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAACGTG
ACCTTGTCCTGTAGCTCCTGGAGCTCCTATGACATCTACCATCTGTCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCG
TGCAGTGCCCAAGGTCAACAGAACATTCCAGGCAGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TCGGCTCTTTCCGTGCCCTGCCCTGCGTGTGGTCAAACTCAAGTGACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCA
AGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTATCTGCAGACACCTGCATGTTCTGATTGGGACCTCAGT
GGTCATCTTCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTTATCGCTGGTGCTCCAACAAAAAGAATGCTGCTGTAATGG
ACCAAGAGCCTGCGGGGGACAGAACAGTGAATAGGCAGGACTCTGATGAACAAGACCCTCAGGAGGTGACGTACGCACAG
TTGGATCACTGCGTTTTCATACAGAGAAAAATCAGTCGCCCTTCTCAGAGGCCCAAGACACCCCTAACAGATACCAGCGT
GTACACGGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTCCTGCCCACGAGCACCACAGTCAGGTCTTGAGGGGG
TTTTCTAG
Genomic Sequence Data (17005 bps)
GTGTGAGAGGTTGGATCTGAGACGTCTTTTGAGTCTGGTCATAGTGAAGGATGCAAGGTGGCAATTGTAGTCACAACAAT
TTCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCC
TCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGC
GCGGCCTCCTGTCTGCACCGGCAGCACCATGTCGCTCACGGTCGTCAGCATGGCGTGCGTTGGTGAGTCCTGGAAGGGAA
TAGAGGGAGGGAGAGTGGGGATGGAGATCTCGGCCTAGAGGTAAAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGT
GGAGATATGGGCCTGGGTGTGGAGATATGGGCCTGGAGGTGTAAATATGGGCCTGGAGTGGAGATATGGGCCTGGAGGGG
AGATATGGGCCTGGGTGTGGAGATATGGGCCTGGAGTGGAGATACGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGA
TATGGGCCTGCAGGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGATGTGGAGATAT
GGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTAGAGGGGAGATCTGGGCCTGGAGTGGAGATATGGGT
CTGATGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATAGGGGCCTGGAGTGGAGATATGGGCCTGG
AGTGGAGATCTGGGCCAGGAAGTGTTGATCTGGGCCTGGAGCCTGGGTCTCTCCACAGCTGAGAGCCCTGTTCTTGGCAG
CAGGTAGCAGGGAGGCTAAGTTTACCTTCAGCCCAGCAAGGGCCTGGCTGCCAAGACACACAGTGCAGTGGGGGCAGCAG
GGTGCCCTGGTTTGCCTGCAGTTGGATCGTCTATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGGCC
ACTCATGGGTGAGTCCGTCCCCAAACCTTAGGGTGTCATCTCCCCACATAAGAGGATTTTTCTGAAACAGGAGGGAAGTC
CTGTCGGGGAGTCTCTCATAAACTAGGAAGAGGGGACCCTTGGATACTCGGCCCACATTTCTGACCTCGCCCTCCCTGGC
CTTTCTTTCCCTTTCCTGAGTCAAGCTCTGTGAAGACTGGGGTGAGACTGGGGTGCTCCAAGCTGGGGTGTGCAGGGAGG
AAGTGGTGTCAGCAGCAGAGAAAGAGAGGGAAGCAGTGCTAGGAACAGCAGGTCCTCTGAGGACAAAGGTATAACTGACA
CCCTCCAGCGTTTCCGTGACGGTAGGGGCTGCAGTGTGGCTGCGGTCTTTCTACCAGAAGAGGGGGGAAACCACAGCCAT
GGCCCTGACATTCCAAATCCTCTGAGGGGGCTCAGTTCATGAATTGGCTGATATTCCACTCACATAGGACATGCCCTCCA
TGCCGTGTCTACTTTGTGTTGTTTTATGTGAGTAATTTTGCAGTATTAAAATCTAGTAAGAGTCACTTATTCAGCACTTG
CTCAAAGTTCTCAGCTGACACTTGTTGTAGGGAGACGCCATGTCTATGTGGGGTGGGTCCTTCCTGTAGCCCTGGGCACC
CAGGTGTGGTAGGAGCCTTAGAAAGCGGAAATGGGAGAATCTTCTGAGCACAGGGAGGGAGGGGTGGCTCCACATCCTCC
TCTCTAAGGCAGTGCCTCCTTCTCCCCCAGGTGGTCAGGACAAACCCTTCCTGTCTGCCCGGCCCAGCACTGTGGTGCCT
CGAGGAGGACACGTGGCTCTTCAGTGTCACTATCGTCGTGGGTTTAACAATTTCATGCTGTACAAAGAAGACAGAAGCCA
CGTTCCCATCTTCCACGGCAGAATATTCCAGGAGAGCTTCATCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACA
GATGTCGGGGTTCACGCCCACACTCCCTCACTGGGTGGTCGGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGTCAG
AGGCTTTCTGTCTGGGCTTCTCACTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGGGTGTCCATCAGGGTCCCATC
ACCCAGGCCCCAACTGTATTTGGGGTCAAGGGAGATTGAATACAGGGGAAATGGGCGCTGTGGTGGGAAGAATAACTGTC
GCCAATGATGGCTACATTGTAAACCCTGGAGCCTGTGACTATTTATGTTATAGGGCAGGGGACTGAAGGGGAAGGTGGAG
CTCAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGACAGCCTGGACTGTCCTGCTGGGCTCAGTGTAATCACAAGGGTC
CGCGTGAGAGGTGGAGGAAGAGGGGAGTGGGGATTAGAGCAGTGTAGTGGGAGGGAGACGCTATCAGCCACTGTGGGCTT
TGAAGGTGGAGGAAGGCCACTAGTCACAGAATGCAGGTGGCCTCTAAGGGCTGGAGAAGTCAAGAGAACTGATTCGCTGA
GTCTCCAGAGGGAACGCAGCCCTGCAGATGCCTTGATTTCAGCACAGGGAGAACTGGATCCAATTTCTGTCCCCAGAAGT
GGAAGGGGTCAGTGTGTTCTCTCCTGCTGCCATGTTTGTGATAATTTTCTGCAGCAGCAACAGGAAACCGACACAGGAAC
CCAGGTCAAGGACAAGCTAGGAAACCAAACAAGGATAGCCAGGTGTGGTGGTGGGCACGAGTAATCCAACGACTGGGGAG
GCTGAGGCAAGAGAATCACTTGAACCGGGGAGGCAGAGGTTGCAGTGAGCCAAGACAACACCACTGCACTCCAGCCTGGG
TGAAAAAGTGACTGTCTCAAAAATAAATTAATTAATCAATTAATTAAAGAAACCAAACAAGGAGAAGGTTGGCTACCGTG
GGATCAGCAAGGGTGGGATGCTGATGCCACCACCAGGCTCCATCCACATAGGAAGGGGTTGATGCTCCTGGAACCAGCAC
CAGGGACCACCCTATGGAAGCTGGGGCCATGGAGAAGGCACAGACATGGCAGGAGAGGCTCCCAATCCCCATCAGGAACA
GGGTGTGTGGACACTGATGTCTGCCTTACTGATGAGTTGATACCTCTGCCAGAGACTCCAATTTGTTCAAAAGAGATTGA
TTCAGGCTGCTGAGAGCCTGGACATGCAGCCTGTCCTCTTCCACCCCCACATAGACAGCAGGAAAGAGACTAGTGGGAAA
GAGATACAACAGCCCAAGAGATGAGGCTCTCTTCACAGTGGGAAGGGAGTCAGGGGCTACTGGAGACAGAGGGACAGAGA
AGAGGGAGGAAGACAAATGGAGGGACCTGCACCAGGGGATATGGGCACAGAAAAGACACGGAGACACAGAGAGGGAGGAG
AGAGACAGACCTCTGGGAGGGGAACCCTCACTCATTCCAGGTGCCATGGATGGGATGATAAAGAGAGATGCCTTCTAAAC
TCACAACTTCTCTTTCTAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGGCCCCTGCTGAAATCAGGAGAGAC
AGTCATCCTGCAATGTTGGTCAGATGTCATGTTTGAGCACTTCTTTCTGCACAGAGATGGGATCTCTGAGGACCCCTCAC
GCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCCCTTGATGCCTGTCCTTGCAGGAACC
TACAGATGTTATGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCCCTGGACATCGTGATCACAGG
TGAGAGTGTCCAGACATTCTTCTCATTGTCATTGGGACACAGAGTGAATGATCCAGGACTTGGAACCCCCAGGTGGTCAT
GAGGAAGATAAGCGTGGGATTCTTATGGAGAGAGACTGACTCGGTGAGGTCTGTACCAACAGAGACAGGGAAACAGGAGA
CATAAGTACAGACCAGGTGTCATAACAGAGGACAGACACAGGGGCCATACGGGGAAGTAGAAAAGAGAGAAAGAGGTAAA
GGAGACACTCAGACAGACAGACATGTGCCAGAGAGAAGTGTCCTTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTT
AGAAGTTTCATTTCTGTTTTGTCTCCACAAAGTGCTTCTACGAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTT
GGGCCCTGTGGCCTCAGGCCTTGTGGCATCTACAGATGCCATGTTTATTCTGACACCTCTGCCTTCCATGCAGTGGAGCC
ATAATTATCCCAGGATATCATGGCCCCAGAACACCAACCCCTAAATACTGTGTGTACTTGGTGTCCCCAGACTAGATTCT
GAGGCTCATATTCCAAATAATCCTACATATAATAGGATCACTGAGAGACACAGAGATAAATCAGGGACTTCAAAAAGCAA
AGGCATAAACACACAGAGAATGAGCCAGAGGAAGGGGATTGAGAGACTCACAGACACACAAAAAGAAAGAAAAGAGGGCA
GAGGAGTGGAGAGAATGCTGGAAGGGAGGAGAGAAAAGCCCCAAAATCAGAACCCTGAGGGAGGGGCACAAAGACAGAGA
AAGATAAAGATGTGGGGATGGATTGCAGAGATTCCAAATAGAACTAGAGAGACTGAGAGGCAGAGAAAGACAAGGAGATG
GAGAGAGACAGATGATAGATGGATAGATAGATATAGATAGATGATAAATAGGTAGATGATAGATAATGGATAGGTTATAG
ATACATAGATGATGATTGATAGATGATACATAGAGATGATGATGATGATGATGATGAAGATAGATAGATAGAAGACACAT
ATATAAATATATAGATACATAGATGATACATAGAGACTGACAGGCAGACAGAGAGGTAATAGAGAGAGAGAGAGATGATA
CATAGATACAGATAATACATAGATGATTGATGGATAGACAGATAGACAATTGATAGATAAATGATACATAGATATAGATG
ACAGATAATTTGTAGATAGACACAAAATAGATAGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACAAGACAGAA
AGTGAGAGACTCAGAATTATAGAAAAAGGAAGATCAAGTCAACCAATCCAAGGAGAGTCAGAGAGAATAAAACAATCCAA
AAAGGGAAAGCATACCCAGGGGTGGGGAAGTGAGGTCAGAGACCTAGAGAGACAGAGAAGGCGGAAGGAGGAAATAGACA
TGAAGAGAGTTGGGGTGGAGGGTGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTA
TGAGGGGAGCTGTGACAAGGAAGAACCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCT
CTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAACGTGACCTTGTCCTGTAGCTCCTGGAGCTCCTATGACATCT
ACCATCTGTCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCGTGCAGTGCCCAAGGTCAACAGAACATTCCAGGCAGAC
TTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGCCCTGCCCTGCGTGTGGTCAAA
CTCAAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAACCCGTGTCTGTCCCATGTCTTATGATCCTAGAGCCATA
GCTGAGGAGCTTCCTGCCGATGATGGGGAGAAGCATGGACAGATGCAGAGAGAACACGAAGACTGGGTGTGAGGGGGGGG
TCAGGGTGCAGGATGGCAGACAGGGCACCTCCAAACCCTCTTGCATGGCCTGCATGGAGGCCCATGGTCAGGGCTCCAGG
CACCCAGGCAGATGGAGAAAGCGGTCAGGACAGACCCAGAGAAGGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGTTC
CCTCAGCCCCTCAACCTTACCCATTTCCCAGAAGCCCATCCTGGCCTCTCACCCACACAGAGAGATGTCATCACCAGCAA
CCCCTACACTCTTTTCTTTTCATTTTCAAAAATATTTATTGAGGTTAAATGTAACTATATAATTTACCAACTTTACCATT
TTTAAAAGTAAAATCTAGTGGTCATAAATACCTTTATATGCTGGGTGTGGTGGTTCACGGTTGTAATCTTGGCGCTTTGA
GAGGCCAAGAAAGGTGGATCATTTAAGATCAGGGACTCGAGATCAGCCTGGCCAACATGCGGGAAATTCATCTTTACTAA
ACAGACAAGAAAAATTAGCCAAGCATGCCGGCATGCACCTGTAGTCCTAGCTACTTGGGAGGCTGAGGCAGGAGAAGCAC
TTAAAGCCAGGAGGCAGAGGTTGCACTGAGCCGAGATCATGCCACTGCACTGCAGCCTGGGAGACAGAGAGAGACTCTGT
TTCTAAATAAATAAATACATCTATATTCTTTTTTTTGTTACCCTCCACCCTTCCCTTCCTGGCCTCTGGTATCCACCATT
CTATTCTCTACCTTCATGAGATCCACCTTTTATCTCCTGCATGTGGTGAGAAATGGGAATCTTTGTAATGACCTCGAGTT
CCATCCATGTGGCTGCAAATGACAGGATGTTATTGTTTCTATGGATGAGTAGTCTCCACCGTGTGTGTGTACTACAGTTC
TCTATCCATTCACCCACTGATAGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGGAACAGTCATATG
AGTGCAGATATCACTTCGATACACTGATGTCCTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGACACTATGAAA
GTTCTCTTTTTTTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGTCCAAGCTGGAGTCAAAGTGGTGCGATCTTGG
CTCATTGCAACCTCTGCTTCCTAGGTTCAAACGATTCTCCTGACTCAGCCTCCCTAGTAGCTGTGATTACAGGTGCACGC
CACCATGCCTGACTAATTCTTGTATTTTTTAGCACAGACGGGATATCCCAATTTTGGGCAGGCTGCTCTCAAACTCCTGA
CCTCAAGTGAGGTGCCTGCCTCGGTTTCCCAAAGTGCTGAAGTTACAGGCATAAGCCACTATGCCCAGCCTCCTTTTAGT
TTTTTAAAGATTTTCCATACTTTTCTCCATAATAGTTGTACTAATTTACATTCCTACCAACAGGGTACCAGGGTTCTCCT
TTCTCTACCATCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGATAAAAGCCATTTTACTTTACTTTATTTATTTATTTAT
TTATGTTGAGATGGAGTTTCACTCATAGTCGCCCAGGCTGGAGTGCAAGGGTGTGATCTCGGCTCACTGCAACCTCTGCC
TCCCGCGTTCAACTGATTCTCCTGCCTCAGCCTCCAAAGTAGCTGGGATTACAGGCATGTGCCACCACGCCTAGCTAATT
TTTGTATGTTTAGTAGAGAGGGAGTTTCTCCATGTTGGTCAGGCTGGTCTCCCGACCTCAGGTGATCCGCCCACCTCCGC
CTCCCAAAGTGCTGGAATTACAGGCGTGAGCCACCGGCCTAAAAGGCATTTTAATGGGATGAGATGAAAACTCATCGCGA
TTGTAATTTACATTTCTGTGATGATGAGTGATGCTGAGCACTTTTTCATATACGTGATCGCCATTTCTATGTTTTGTTTG
TGGAGAAATGTCTCCTCATGTCTTTTGCTCGTTTTTTAATTAAATTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCC
AGTTATTAATCCCATCTCAGATGAATAGTTTGCAAATATTTGCTCCTATTTTGTGGGTTGTCTCTTCACTTTGTTGGTTT
ATCTTTGGTGGTGCAGAAGTTGCTTGGTTTGATGTAATCCTAATGGTCTATTTTTTGCTTTGATTACTTGTGTTTTGAAG
GTTTTAAACAAAATGTCTTTCGTCAGACAAATGTCTTCCCCATTATTTTCTTCTACATGTTTCATAGGTTCAGGCCTTAG
ACTCATGTTTTTAATCCATTTTCATTTGATTTTTGTGTAAGGTGACAGGTATAGATGCAGTTTTATTCCTCTGCATGTAG
ATATCCAGTTTTCCCCACACCATTTATTGAAGACTGTCCTTTCCTGATTGTAAGTTCTCGGCACCTTTGTCAAAGTCCAT
TAAATGGGCTGGGTATGGTGGCTCACACCTGCAATTCCAGCACTTTGGGAGGCCGAGGCGGGTGGATCACCTAAAGCCAG
GAGTTCAAGACCAGGCTGGCCAACAGAGTGAAACCTCGTCTCTACTAAAAATACAAAAATTAGCTGAGCATGGTGATCAG
TGCCTGTAATACCACTACTCAGGAGTTTGAAGCAAGAGAATTTCTTGAATCCAGGAAGTGGAGGTTGCATTGAGCTGAGA
TTGCACCTCTACACTCCAGCCTGCATGACAGAGCAAGATTCTATCACACACACACAAAAGAAAGCCATTGGATGTAAATG
CATGGATTATATCTGTGTTCTCCATTCTGTTCCATTTTTTATGTGCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTA
CTACAGCTCTGTAACATATTTCTAAGTCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTCAAGTCTCAAGACAGT
GGGCATCGCACACAAAAATTATGGAGAAAAGGATCCCAAGACTCCCAGGGTCCAACATTAGATAACAGAGTGTTGGCCAT
GAACCAACCTCAAAGATTTCCATTGAGTAGAGGACAAGCACCCTCATTTCCTCACATCTCTCCTGTCCCGTGTTCTAGGA
AACCCTTCAAGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTGAGTAAAGGACCCCTCTTATCTCTGCTTT
TGGAAACCTGGGGAGGTGGAAGCCTTGGATGCAAGTGTTGGCTCAAACCTCCCAGCTCTGTGAATGAGGGCCTGTCTTCC
ACCATCTCTGAACTCCAGACACTCCAACAGTGAAAGGGATCTAGGGCCACCAAAGGGCTCAGCGAAGTCTCTTTACCTTT
AATTTCCTGCAGGTGAGACCTCCTACAAGCTAGAAGAATAATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAGTGTT
TTTTCTGCCTGCATTCCTAACTGGAGGATAAATTCCCGGGGGCTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGT
GGGTGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAATTACTGTTGGTCATCAGGCAACCCTGGCTGACTCAGCAGAGCA
AGAGCCTTGCCGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTC
AGGCTGTGCAGTGTGGAAGCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTA
TTTAATTATCTTACAGTGCTGTAGCTCAAAGCATGACGTGCATGTCACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCC
TTCCCTCTGAGGGTTCCAGGCAAGAATCTGCTTCTCACTTTTCTCAGCTTCTAGAGGCTCCCATGTTCCTTGGCTCCTGG
TACCCTTCCTCCTTCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACA
CCTCTTTCTCTGAATGCTGCTCTCCCTTCTTGCCCTTCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAA
ATCCATCATAATCTCCCGGAAATCATCCAGGATACCCTCCTTTTAAGTTCAGCTGACTAGCAACCATAATTCCATCTGCA
ATCTTCATTCCTCCTTTCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACATGGACATTTTTGGGGTGGGACA
ACATTCTCCTGCCTTCCACAAACAGTGAACAAGATGCATTTGGCCTCTGTTCTTGGGACACTGATCTTGCAGATGGTTAA
ATGGGAGGGCAGAAAATGTAGGCACAAGGGGACCAATAAATGAATGATCTATTGAGAAGCATCTGTGCATGAAATCTATT
TATTTATGTATTTACCTACTTGTTTATTGAGACGGAGCCTTGCTCTGTCGTCCAGGCTAGAGTGCAGTGGCATGATCTCG
GCTCACTGCAACCTCCACCTCCTGGGCTGAACTGATCTCCTCCCTCAGCCTCTCCAGTAGCTGGGATTACAGACCACAAC
CACCACGCCCGGCTAACTCTTTTTGCATATTTTCTGTAGAGAGGATGTTTCACCATGTTGGCCAGGCTGGTCTCAAATTC
CCAACCTCAGGTGATCCAATAGCCTCTGCCTCCCAACACGCTGGGATAAGAGGCATGAGCCACGGGGCCAAGCCAAATTT
TCAAATCAATAATAGATAATGCTGAGTGTATGATTTCAGGTGACAGAGAAGTTCTCACTAATCAGATATTTGTGACATTA
ATGAAAAACACGGATTGAACCCCTGGAAGATTGGCAGAAGGATTTTCCACACAGCTGTCAGCCGTGAAGGCACAAAGGTG
AAAACAATCTGATGTGGAAGGAAGAGGCTCTGCCTGAAATGCCGGGAATGAGATGGGGAGAATGACAAGACGACTGTGGA
GAGACGGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCCTTGGATTC
ACCTCGGGGTAACCAGGAATCCCTACATGATTAATATGACTGACATGAAAATAAGGGAGGCTCAGGTGCATAACTGGAAT
CTAGGAGACCGTGGAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGA
TGGATATAAGATATGTTTGTGAGGTAGAATCATTGACTGGAAACGCTTACTGGGTTTAATTTTTCCTGGTAGTTTAATCC
TTGCTTCACTAACTTATTTCTGAGATTTATTTCTCCTGCATCTAAATCAATACCTGGCAGAGGAGGGAGAGCTAGATGAG
GGGTGGTGCAAATGAAGGGACCTAGTATAGCATAATATACAAGGCTGTGAACGGTGGCTCACGCCTGTAACCCAGCACTT
CAGGAGGCCAACGCGGGTGGATCACATGAAGTCAGGAGTTCGAGACCAGCCTGGCCAACATGGAGAAACCCTATCTCTAC
TAAAAATACAAAAATTAAACAGGCATGATGGTGGTGCATGACTGTAATCCCAGCTACTCTGGAGGAGGAAGCAGGAGAAT
GACTTCAGCCCTGGAGGCAGAGGTTGCAGTGAGTGGAGATCGCATCACTGCACACCAGCCTGGGCTACACAGGGATACTC
TGTCTCAAAAAATAAAAATAAAAAATACATAAATATAATAATATACACAAATGATGCAGGCACCTGAATTCCAATCATCA
TTTTTCTATTCCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGAAAATCAGCCTAAAACCTCTTCCATATTT
GGCTTTCTGTGAACATGAGATCATATGGAAAATATGAAAGCCCCCTGAACCCACCAGCACAGGCCCTGAAATAGGGAAAG
TGCTCTGTTCATCACAAGAAACTTTCCCCCTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCACCTGTGGAGATAC
AGATAGATCATGGGGAGGTAAACGCTAATACTCCTTGGAGTGAGTTCAGATCTTGGAATCAGAGATCAGCACCAGCACTA
GCTCCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTTTTGAAGCAATAGATGGTGGAGGGGGTGGTCTTTCC
CCCAGCCTCTCAGGTGGAACAGCAGCCTAACATGTGTCTCGCGAGATCACAAAGAGTAGCACGTTTCACATGGGCTTCAT
CATTATTTCCTGGCTGTTTGACATAAGAGAATTCTACTTTGCTTTTTTGATCTTGATTTCACTTTTGTGTCCTTTTCTTG
GAGAATGTAATTTGAGTCAAGAGGGTTGTGGATGTAGAAACTGTAAAGCACATTCACTGTGTATCAATCCCAGTCCAGTC
TTTCCAGAGAAGACTCTAAACACCTGCTGTACTGCACCTGGGCCTATGCCAATTTCTATCACTCACCGTCACTCCAGGGA
GACAGAACACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTACAT
TTCAACGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTGCTCGGGACATATGGAGTCACCTCATTTGCAGTGTATCTGGGG
GAAGCCAGAAAATAGCCCAGCCTGGGTTTTGTACCCTGAAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCT
CCTCCAGGAAGAACAGGAAGACAGCACAGGCTGTTCTGAGACGTTCCTCCTGATCTCAGGACGTTGCTGTCTTAGTCCAT
TTTTGTTGCTATAAAAGAACACTTGAGCCTGGGTTACTTCTTTTTTTTTTTTTTTTTTTTTGTATAGTGCTTCTGATGAG
CTTTTTTTTAAAATTTTTATTATTATTATACTTTAAGTTTTAGGGTACATGTGCACAATGTGCAGGTTAGTTACATATGT
ATACATGTGCCATGCTGGTGTGCTGCACCCATCAACTCGTCATTTAGCATTAGGTATATCTCCTAATGCTATCCCTCCCC
CCTCCCCCCACCCCACAACAGTCCCCAGAGTGTGATGTTCCCCTTCCTGTGTCCATGTGTTCTCATTGTTCAATTCCCAC
CTATAAGTGAGAACATGCGGTGTTTGGATTTTTGTCCTTGTGATAGTCTACTGAGAATGATGATTTCCAATTTCATCCAT
GTCCCTGCAAAGGACATGAACTCATCATTTTTTATGGCTGCATAGTATTCCATGGTGTATATGTGCCACATTTTCTTCAT
CCAGTCTATCATTGTTGGACATTTGGGTTGGTTCCAAGTCTTTGCTATTGTGAATAGTGCCACAATAAACATACGTGTCC
ATGTGTCTTTATAGCAGCATGATTTATAGTCCTTTGGGTTTATACCCAGTAATGGGATGGCTGGGTCAAATGGTATTTCA
AGCTCTAGATCCCTGAGGAATCGCCACACTGACTTCCACAATGGTTGAACTAGTTTACAGTCCCACCAACAGTGTAAAAG
TGTTCCTATTTCTCCACATCCTCTCCAGCACCTGTTGTTTCCCGACTTTTTAATGATCGCCATTCTAACTGGTGTGAGAT
GGTATCTCATTGTGGTTTTGATTTGCATTTCTCTGATGGCCAGTCATGGTGAGCATTTTTTCATGTGTTTTTTGGCTGCA
TAAATGTCTTCTTTTGAGAAGTGTCTGTTCATGTCCTTTGCCCACTTTTTGATAGGATTGTTTGTTTTTTTCTTGTAAAT
TTGTTTGAGTTCATTGTAGATTCTGGATATTAGCCCTTTGTCAGATGAGTAGGTTGCGAAAATTTTCTCCCATTTTGTAG
GTTGTCTGTTCACTCTGATGGTAGTTTCTTTTGCTGTGCAGAAGCTCTTTAGTTTAATTAGATCCCGTTTGTCAATTTTG
GCTTTTGTTGCCGTTGCTTTTGGTGTTTTAGACATGAAGTCCTTGTCCATGCCTATGTCCTGAATGGTAATGCCTAGGTT
TTCTTCTAGGGTTTTTATGGTTTTAGGTCTAACGTTTAAGTCTTTAATCCATCTCAAATTAATTTTTGTATAAGGTGTAA
GGAAGGGATCCAGTTTCAGCTTTCTACCTATGGCTAGCCAGTTTTCCCAGCACCATTTATTAAATAGGGAATCCTTTCCC
CATTGCTTGTTTTTCTCAGGTTTGTCAAAGATCACATAGTTGTAGATATGTGGCATTATTTCTGAGGGCTCTATTCTGTT
CCATTGATCTATATCTCTGTTTTGGTACCAGTACCATGCTGTTTTGGTTACTGTAGCCTTGTAGTATAGTTTGAAGTCAG
GCAGCATGATGCCTCCAGCTTTGTTCTTTTGGCTTAGGATTGACTTGGCAATGCAGGCTCTTTTTTGATTCCATATGAAC
TTTAAGGTAGTTTTTTCCAATTCTGTGAAGAAAGTCATTGGTAGCTTGATGGGGATGGCATTGAATCTATAAATTACCTT
GGGCAGTATGGCCATTTTCACGATCTTGATTCTTCCTACCCATGAGCATGGAATGTTCTTCCATTTGTTTGTATCCTCTT
TTATTTCATTGAGCAGTGGTTTGTAGTTCTCCTTGAAGAGGTCCTTCATATCCCTTGTAAGTTGGATTCCTAGGTATTTT
ATTCTCTTTGAAGCAATTGTGAATGGGAGTTCACTCATGATTTGGCTCTCTGTTTGTCTGTTATTGGTGTATAAGAATGC
TTGTGATTTTTGTACATTGATTCTGTATCCTGAGACTTTGTAGAAGCTGCTTATCAGCTTAAGGAGATTTTGGGCTGAGA
CAATGGGGTTTTCTATATATACAATCATGTCATCTGCAAACAGGGACAATTTGACTTCCTCTTTTCCTAATTGAATACCC
TTTATTTCCTTCTCCTGCCTAATTGCCCTGGCCAGAACTTCCAACACTATGTTGAATAGGAGTGGTGAAAGAGGGCATCC
CTGTCTTGTGCCAGTTTTCAAAGGGAATGCTTCCAGTTTTTGCCCATTCAGTATGATACTGGCTGTGGGTTTGTTATAGA
TGGCTCTTATTATTTTGAGATACGTCCCATCAATGCCTAATTTATTGAGAGTTTTTAGCATGAAGCGTTGTTGAATTTTG
TCAAAGGCCTTTTCTGCATCTATTGAGATAATCGTCCGGTTTTTGTCTTTGGTTCTGTTTATATGATGGATTACATTTAT
TGATTTGCATATATTGAACCAGCCTTGCATCCCAGAGCCTGGGCAACTTCTAGAGAAAACAGATTTGTTTGCCTCACAGT
TCTGCAGGCTGTACTGGAAGCATGGCACCAGCATCTGTTTCCTGTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGG
AAGGAGGGTCTGTCTGTGCAGAGACCACAGAGATCACATGGCAAGAGAGGGAGCAAGGGGGAGGGCGAGCGATGGAGCTT
CCAAGCTCTTTTTAACAACCAGCCCTCCGGGAACTAATAGAGGGGGAACTTGCTAACCCCATCATGTGGGGCAGCATTAA
TCTATTCATGATGGATCCACCTCCATGACTCAAACACCTTCCCATAGGCCCAAACTTCCACACTGGGGGTTAAATTTCAA
TATTTCAGTGTGAGGTTTCAAAGGGTCAAACATCTAAACTAAAGCAGCTGTATCCTCAGCATGTTCTATGGTTTCTATGA
GAGCTGTAACTGAGAAAGCAGGAGAAAGCTGGGTCTCCCGCCATCAGGCTGCTTGTCCTAAGGAGATGTTCCATGTGGTT
ACCTGTCAATCAAGAAATGAGACAATCCATAAAGAGGAACTGCTATGATTAGCTTCTTATTGGATTCCCATCTTCCTCCA
GGTATCTGCAGACACCTGCATGTTCTGATTGGGACCTCAGTGGTCATCTTCCTCTTCATCCTCCTCCTCTTCTTTCTCCT
TTATCGCTGGTGCTCCAACAAAAAGAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGA
TGGGAGCACGCGGGTGTGTGTTCCTCACTGGCAGGATGGTCCCTGGCCCAAGGGAGGAGCCACAGAGGCAGGGCTTTCTA
GAGAGAGCACCAGACAACCTGCCCCTGCCTTCAGCTCACAGACCATTGCCTGGTTCTGAACTGTATCCTCACATCCCCTG
CAGCCACTGACATCCAGAAGCTTCCATGACAGGCAGAAAGTGGGAGACAGAATCAATGGGATGCCAATTGAGAGCACTTC
ATGGGATGGGGTCTTGAACTCAGAGAGATAGAATGTCTGAGTCTGGATGTTGGCAGCTGAAGAGCCTCAGGCACCTACAG
CCTCCCCCTGTGGGTTGGTGTCTGCCCATGAAATGAGGACCCAGAAGGGCCCTCCAAGCGGTTTTGATGACTTCCGTCTC
CTACAGATGCTGCTGTAATGGACCAAGAGCCTGCGGGGGACAGAACAGTGAATAGGCAGGTAGGTCCTCCTCGGCCCAGC
CTCACGGATACAGTCTTATCCCTAATAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGA
CTCTGATGAACAAGACCCTCAGGAGGTGACGTACGCACAGTTGGATCACTGCGTTTTCATACAGAGAAAAATCAGTCGCC
CTTCTCAGAGGCCCAAGACACCCCTAACAGATACCAGCGTGTACACGGAACTTCCAAATGCTGAGCCCAGATCCAAAGTT
GTCTCCTGCCCACGAGCACCACAGTCAGGTCTTGAGGGGGTTTTCTAGGGAGACAACAGCCCTGTCTCAAAACCAGGTTG
CCAGATCCAATGAACCAGCAGCTGGAATCTGAAGGCATCAGTCTGCATCTTAGGGGATCGCTCTTCCTCACACCACGAAT
CTGAACATGCCTCTCTCTTGCTTACAAATGCCTAAGGTCGCCACTGCCTGCTGCAGAGAAAACACACTCCTTTGCTTAGC
CCACAAGTATCTATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCCTACTTGAGGCTGCA
ATCACACTGAGGAACTCACAATTCCAAACATACAAGAGGCTCCCTCTTAACACGGCACTTACACACTTGCTGTTCCACCT
TCCCTCATGCTGTTCCACCTCCCCTCAGACTATCTTTCAGCCTTCTGTCATCAGTAAAATTTATAAATTTTTTTTATAAC
TTCAGTGTAGCTCTCTCCTCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR