Allele Report for 3DL2*0020106


3DL2*0020106
Previous Designations & Local Names: 3DL2_G248_Ahap_final
IPD Acc No: KIR00640
Assigned: 31-MAR-2010 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182350  
Cells Sequence Derived From: G248  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (455 aa)
MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESF
IMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHRDGI
SEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENV
TLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPS
SSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQ
LDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
Nucleotide Sequence Data (1368 bps)
ATGTCGCTCACTGTCGTCAGCATGGCGTGCGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACTCATGGGTGGTCAGGA
CAAACCCTTCCTGTCTGCCCGGCCCAGCACTGTGGTGCCTCGAGGAGGACACGTGGCTCTTCAGTGTCACTATCGTCGTG
GGTTTAACAATTTCATGCTGTACAAAGAAGACAGAAGCCACGTTCCCATCTTCCACGGCAGAATATTCCAGGAGAGCTTC
ATCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTCGGGGTTCACGCCCACACTCCCTCACTGGGTGGTC
GGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGGCCCCTGC
TGAAATCAGGAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCATGTTTGAGCACTTCTTTCTGCACAGAGATGGGATC
TCTGAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCCCTTGATGCC
TGTCCTTGCAGGAACCTACAGATGTTATGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCCCTGG
ACATCGTGATCACAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAACGTG
ACCTTGTCCTGTAGCTCCTGGAGCTCCTATGACATCTACCATCTGTCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCG
TGCAGTGCCCAAGGTCAACAGAACATTCCAGGCAGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TCGGCTCTTTCCGTGCCCTGCCCTGCGTGTGGTCAAACTCAAGTGACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCA
AGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTATCTGCAGACACCTGCATGTTCTGATTGGGACCTCAGT
GGTCATCTTCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTTATCGCTGGTGCTCCAACAAAAAGAATGCTGCTGTAATGG
ACCAAGAGCCTGCGGGGGACAGAACAGTGAATAGGCAGGACTCTGATGAACAAGACCCTCAGGAGGTGACGTACGCACAG
TTGGATCACTGCGTTTTCATACAGAGAAAAATCAGTCGCCCTTCTCAGAGGCCCAAGACACCCCTAACAGATACCAGCGT
GTACACGGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTCCTGCCCACGAGCACCACAGTCAGGTCTTGAGGGGG
TTTTCTAG
Genomic Sequence Data (16995 bps)
GTGTGAGAGGTTGGATCTGAGACGTCTTTTGAGTCTGGTCATAGTGAAGGATGCAAGGTGGCAATTGTAGTCACAACAAT
TTCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCC
TCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGC
GCGGCCTCCTGTCTGCACCGGCAGCACCATGTCGCTCACTGTCGTCAGCATGGCGTGCGTTGGTGAGTCCTGGAAGGGAA
TAGAGGGAGGGAGAGTGGGGATGGAGATCTCGGCCTAGAGGTAAAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGT
GGAGATATGGGCCTGGGTGTGGAGATATGGGCCTGGAGGTGTAAATATGGGCCTGGAGTGCAGATATGGGCCTGGAGGGG
AGATATGGGCCTGGGTGTGGAGATATGGGCCTGGAGTGGAGATACGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGA
TATGGGCCTGCAGGTGGAGATCTGGGCCTGGAGTGGAGATATGGGTCTGATGTGGAGATATGGGCCTGGAGTGGAGATAT
GGGCCTGGAGTGGAGATATGGGCCTAGAGGGGAGATCTGGGCCTGGAGTGGAGATATGGGTCTGATGTGGAGATATGGGC
CTGGAGTGGAGATAGGGGCCTGGAGTGGAGATAGGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATCTGGGCCAGG
AAGTGTTGATCTGGGCCTGGAGCCTGGGTCTCTCCACAGCTGAGAGCCCTGTTCTTGGCAGCAGGTAGCAGGGAGGCTAA
GTTTACCTTCAGCCCAGCAAGGGCCTGGCTGCCAAGACACACAGTGCAGTGGGGGCAGCAGGGTGCCCTGGTTTGCCTGC
AGTTGGATCGTCTATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACTCATGGGTGAGTCCTTC
CCCAAACCTTAGGGTGTCATCTCCCCACATAAGAGGATTTTTCTGAAACAGGAGGGAAGTCCTGTCGGGGAGTCTCTCAT
AAACTAGGAAGAGGGGACCCTTGGATACTCGGCCCACATTTCTGACCTCGCCCTCCCCGGCCTTTCTTTCCCTTTCCTGA
GTCAAGCTCTGTGAAGACTGGGGTGAGACTGGGGTGCTCCAAGCTGGGGTGTGCAGGGAGGAAGTGGTGTCAGCAGCAGA
GAAAGAGAGGGAAGCAGTGCTAGGAACAGCAGGTCCTCTGAGGACAAAGGTATAACTGACACCCTCCAGCGTTTCCGTGA
CGGTAGGGGCTGCAGTGTGGCTGCGGTCTTTCTACCAGAAGAGGGGGGAAACCACAGCCATGGCCCTGACATTCCAAATC
CTCTGAGGGGGCTCAGTTCATGAATTGGCTGATATTCCATTCACATAGGACATGCCCTCCATGCCGTGTCTACTTTGTGT
TGTTTTATGTGAGTAATTTTGCAGTATTAAAATCTAGTAAGAGTCACTTATTCAGCACTTGCTCAAAGTTCTCAGCTGAC
ACTTGTTGTAGGGAGACGCCATGTCTATGTGGGGTGGGTCCTTCCTGTAGCCCTGGGCACCCAGGTGTGGTAGGAGCCTT
AGAAAGCGGAAATGGGAGAATCTTCTGAGCACAGGGAGGGAGGGGTGGCTCCACATCCTCCTCTCTAAGGCAGTGCCTCC
TTCTCCCCCAGGTGGTCAGGACAAACCCTTCCTGTCTGCCCGGCCCAGCACTGTGGTGCCTCGAGGAGGACACGTGGCTC
TTCAGTGTCACTATCGTCGTGGGTTTAACAATTTCATGCTGTACAAAGAAGACAGAAGCCACGTTCCCATCTTCCACGGC
AGAATATTCCAGGAGAGCTTCATCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTCGGGGTTCACGCCC
ACACTCCCTCACTGGGTGGTCGGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGTCAGAGGCTTTCTGTCTGGGCTT
CTCACTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGGGTGTCCATCAGGGTCCCATCACCCAGGCCCCAACTGTAT
TTGGGGTCAAGGGAGATTGAATACAGGGGAAATGGGCGCTGTGGTGGGAAGAATAACTGTCGCCAATGATGGCTACATTG
TAAACCCTGGAGCCTGTGACTATTTATGTTATAGGGCAGGGGACTGAAGGGGAAGGTGGAGCTCAGGTTGTTGATGAGTT
GACCTTGAGATGGGGAGACAGCCTGGACTGTCCTGCTGGGCTCAGTGTAATCACAAGGGTCCGCGTGAGAGGTGGAGGAA
GAGGGGAGTGGGGATTAGAGCAGTGTAGTGGGAGGGAGACGCTATCAGCCACTGTGGGCTTTGAAGGTGGAGGAAGGCCA
CTAGTCACAGAATGCAGGTGGCCTCTAAGGGCTGGAGAAGTCAAGAGAACTGATTCGCTGAGTCTCCAGAGGGAACGCAG
CCCTGCAGATGCCTTGATTTCAGCACAGGGAGAACTGGATCCAATTTCTGTCCCCAGAAGTGGAAGGGGTCAGTGTGTTC
TCTCCTGCTGCCATGTTTGTGATAATTTTCTGCAGCAGCAACAGGAAACCGACACAGGAACCCAGGTCAAGGACAAGCTA
GGAAACCAAACAAGGATAGCCAGGTGTGGTGGTGGGCACGAGTAATCCAACGACTGGGGAGGCTGAGGCAAGAGAATCAC
TTGAACCGGGGAGGCAGAGGTTGCAGTGAGCCAAGACAACACCACTGCACTCCAGCCTGGGTGAAAAAGTGACTGTCTCA
AAAATAAATTAATTAATCAATTAATTAAAGAAACCAAACAAGGAGAAGGTTGGCTACCGTGGGATCAGCAAGGGTGGGAT
GCTGATGCCACCACCAGGCTCCATCCACATAGGAAGGGGTTGATGCTCCTGGAACCAGCACCAGGGACCACCCTATGGAA
GCTGGGGCCATGGAGAAGGCACAGACATGGCAGGAGAGGCTCCCAATCCCCATCAGGAACAGGGTGTGTGGACACTGATG
TCTGCCTTACTGATGAGTTGATACCTCTGCCAGAGACTCCAATTTGTTCAAAAGAGATTGATTCAGGCTGCTGAGAGCCT
GGACATGCAGCCTGTCCTCTTCCACCCTCACATAGACAGCAGGAAAGAGACTAGTGGGAAAGAGATACAACAGCCCAAGA
GATGAGGCTCTCTTCACAGTGGGAAGGGAGTCAGGGGCTACTGGAGACAGAGGGACAGAGAAGAGGGAGGAAGACAAATG
GAGGGACCTGCACCAGGGGATATGGGCACAGAAAAGACACGGAGACACAGAGAGGGAGGAGAGAGACAGACCTCTGGGAG
GGGAACCCTCACTCATTCCAGGTGCCATGGATGGGATGATAAAGAGAGATGCCTTCTAAACTCACAACTTCTCTTTCTAG
GAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGGCCCCTGCTGAAATCAGGAGAGACAGTCATCCTGCAATGTTGG
TCAGATGTCATGTTTGAGCACTTCTTTCTGCACAGAGATGGGATCTCTGAGGACCCCTCACGCCTCGTTGGACAGATCCA
TGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCCCTTGATGCCTGTCCTTGCAGGAACCTACAGATGTTATGGTTCTG
TTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCCCTGGACATCGTGATCACAGGTGAGAGTGTCCAGACATTC
TTCTCATTGTCATTGGGACACAGAGTGAATGATCCAGGACTTGGAACCCCCAGGTGGTCATGAGGAAGATAAGCGTGGGA
TTCTTATGGAGAGAGACTGACTCGGTGAGGTCTGTACCAACAGAGACAGGGAAACAGGAGACATAAGTACAGACCAGGTG
TCATAACAGAGGACAGACACAGGGGCCATACGGGGAAGTAGAAAAGAGAGAAAGAGGTAAAGGAGACACTCAGACAGACA
GACATGTGCCAGAGAGAAGTGTCCTTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTT
TGTCTCCACAAAGTGCTTCTACGAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGC
CTTGTGGCATCTACAGATGCCATGTTTATTCTGACACCTCTGCCTTCCATGCAGTGGAGCCATAATTATCCCAGGATATC
ATGGCCCCAGAACACCAACCCCTAAATACTGTGTGTACTTGGTGTCCCCAGACTAGATTCTGAGGCTCATATTCCAAATA
ATCCTACATATAATAGGATCACTGAGAGACACAGAGATAAATCAGGGACTTCAAAAAGCAAAGGCATAAACACACAGAGA
ATGAGCCAGAGGAAGGGGATTGAGAGACTCACAGACACACAAAAAGAAAGAAAAGAGGGCAGAGGAGTGGAGAGAATGCT
GGAAGGGAGGAGAGAAAAGCCCCAAAATCAGAACCCTGAGGGAGGGGCACAAAGACAGAGAAAGATAAAGATGTGGGGAT
GGATTGCAGAGATTCCAAATAGAACTAGAGAGACTGAGAGGCAGAGAAAGACAAGGAGATGGAGAGAGACAGATGATAGA
TGGATAGATAGATATAGATAGATGATAAATAGGTAGATGATAGATAATGGATAGGTTATAGATACATAGATGATGATTGA
TAGATGATACATAGAGATGATGATGATGATGATGATGAAGATAGATAGATAGAAGACACATATATAAATATATAGATACA
TAGATGATACATAGAGACTGACAGGCAGACAGAGAGGTAATAGAGAGAGAGAGAGATGATACATAGATACAGATAATACA
TAGATGATTGATGGATAGACAGATAGACAATTGATAGATAAATGATACATAGATATAGATGACAGATAATTTGTAGATAG
ACACAAAATAGATAGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACAAGACAGAAAGTGAGAGACTCAGAATTA
TAGAAAAAGGAAGATCAAGTCAACCAATCCAAGGAGAGTCAGAGAGAATAAAACAATCCAAAAAGGGAAAGCATACCCAG
GGGTGGGGAAGTGAGGTCAGAGACCTAGAGAGACAGAGAAGGCGGAAGGAGGAAATAGACATGAAGAGAGTTGGGGTGGA
GGGTGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTATGAGGGGAGCTGTGACAAG
GAAGAACCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCC
ACGGTTCAGGCAGGAGAGAACGTGACCTTGTCCTGTAGCTCCTGGAGCTCCTATGACATCTACCATCTGTCCAGGGAAGG
GGAGGCCCATGAACGTAGGCTCCGTGCAGTGCCCAAGGTCAACAGAACATTCCAGGCAGACTTTCCTCTGGGCCCTGCCA
CCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGCCCTGCCCTGCGTGTGGTCAAACTCAAGTGACCCACTGCTT
GTTTCTGTCACAGGTGAGGAAAACCCGTGTCTGTCCCATGTCTTATGATCCTAGAGCCATAGCTGAGGAGCTTCCTGCCG
ATGATGGGGAGAAGCATGGACAGATGCAGAGAGAACACGAAGACTGGGTGTGAGGGGGGGGTCAGGGTGCAGGATGGCAG
ACAGGGCACCTCCAAACCCTCTTGCATGGCCTGCATGGAGGCCCATGGTCAGGGCTCCAGGCACCCAGGCAGATGGAGAA
AGCGGTCAGGACAGACCCAGAGAAGGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGTTCCCTCAGCCCCTCAACCTTA
CCCATTTCCCAGAAGCCCATCCTGGCCTCTCACCCACACAGAGAGATGTCATCACCAGCAACCCCTACACTCTTTTCTTT
TCATTTTCAAAAATATTTATTGAGGTTAAATGTAACTATATAATTTACCAACTTTACCATTTTTAAAAGTAAAATCTAGT
GGTCATAAATACCTTTATATGCTGGGTGTGGTGGTTCACGGTTGTAATCTTGGCGCTTTGAGAGGCCAAGAAAGGTGGAT
CATTTAAGATCAGGGACTCGAGATCAGCCTGGCCAACATGCGGGAAATTCATCTTTACTAAACAGACAAGAAAAATTAGC
CAAGCATGCCGGCATGCACCTGTAGTCCTAGCTACTTGGGAGGCTGAGGCAGGAGAAGCACTTAAAGCCAGGAGGCAGAG
GTTGCACTGAGCCGAGATCATGCCACTGCACTGCAGCCTGGGAGACAGAGAGAGACTCTGTTTCTAAATAAATAAATACA
TCTATATTCTTTTTTTTGTTACCCTCCACCCTTCCCTTCCTGGCCTCTGGTATCCACCATTCTATTCTCTACCTTCATGA
GATCCACCTTTTATCTCCTGCATGTGGTGAGAAATGGGAATCTTTGTAATGACCTCGAGTTCCATCCATGTGGCTGCAAA
TGACAGGATGTTATTGTTTCTATGGATGAGTAGTCTCCACCGTGTGTGTGTACTACAGTTCTCTATCCATTCACCCACTG
ATAGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGGAACAGTCATATGAGTGCAGATATCACTTCGA
TACACTGATGTCCTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGACACTATGAAAGTTCTCTTTTTTTTTTTTT
CTTTTTTGAGAAAGAGTTTCCCTCCTTAGTCCAAGCTGGAGTCAAAGTGGTGCGATCTTGGCTCATTGCAACCTCTGCTT
CCTAGGTTCAAACGATTCTCCTGACTCAGCCTCCCTAGTAGCTGTGATTACAGGTGCACGCCACCATGCCTGACTAATTC
TTGTATTTTTTAGCACAGACGGGATATCCCAATTTTGGGCAGGCTGCTCTCAAACTCCTGACCTCAAGTGAGGTGCCTGC
CTCGGTTTCCCAAAGTGCTGAAGTTACAGGCATAAGCCACTATGCCCAGCCTGCTTTTAGTTTTTTAAAGATTTTCCATA
CTTTTCTCCATAATAGTTGTACTAATTTACATTCCTACCAACAGGGTACCAGGGTTCTCCTTTCTCTACCATCTTGCCAG
CATTTGTTTTGCCTGTCTTGCAGATAAAAGCCATTTTACTTTACTTTATTTATTTATTTATTTATGTTGAGATGGAGTTT
CACTCATAGTCGCCCAGGCTGGAGTGCAAGGGTGTGATCTCGGCTCACTGCAACCTCTGCCTCCCGCGTTCAACTGATTC
TCCTGCCTCAGCCTCCAAAGTAGCTGGGATTACAGGCATGTGCCACCACGCCTAGCTAATTTTTGTATGTTTAGTAGAGA
GGGAGTTTCTCCATGTTGGTCAGGCTGGTCTCCCGACCTCAGGTGATCCGCCCACCTCCGCCTCCCAAAGTGCTGGAATT
ACAGGCGTGAGCCACCGGCCTAAAAGGCATTTTAATGGGATGAGATGAAAACTCATCGCGATTGTAATTTACATTTCTGT
GATGATGAGTGATGCTGAGCACTTTTTCATATACGTGATCGCCATTTCTATGTTTTGTTTGTGGAGAAATGTCTCCTCAT
GTCTTTTGCTCGTTTTTTAATTAAATTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCCAGTTATTAATCCCATCTCA
GATGAATAGTTTGCAAATATTTGCTCCTATTTTGTGGGTTGTCTCTTCACTTTGTTGGTTTATCTTTGGTGGTGCAGAAG
TTGCTTGGTTTGATGTAATCCTAATGGTCTATTTTTTGCTTTGATTACTTGTGTTTTGAAGGTTTTAAACAAAATGTCTT
TCGTCAGACAAATGTCTTCCCCATTATTTTCTTCTACATGTTTCATAGGTTCAGGCCTTAGACTCATGTTTTTAATCCAT
TTTCATTTGATTTTTGTGTAAGGTGACAGGTATAGATGCAGTTTTATTCCTCTGCATGTAGATATCCAGTTTTCCCCACA
CCATTTATTGAAGACTGTCCTTTCCTGATTGTAAGTTCTCGGCACCTTTGTCAAAGTCCATTAAATGGGCTGGGTATGGT
GGCTCACACCTGCAATTCCAGCACTTTGGGAGGCCGAGGCAGGTGGATCACCTAAAGCCAGGAGTTCAAGACCAGGCTGG
CCAACAGAGTGAAACCTCGTCTCTACTAAAAATACAAAAATTAGCTGAGCATGGTGATCAGTGCCTGTAATACCACTACT
CAGGAGTTTGAAGCAAGAGAATTTCTTGAATCCAGGAAGTGGAGGTTGCATTGAGCTGAGATTGCACCTCTACACTCCAG
CCTGCATGACAGAGCAAGATTCTATCACACACACACAAAAGAAAGCCATTGGATGTAAATGCATGGATTATATCTGTGTT
CTCCATTCTGTTCCATTTTTTATGTGCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTACTACAGCTCTGTAACATAT
TTCTAAGTCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTCAAGTCTCAAGACAGTGGGCATCGCACACAAAAAT
TATGGAGAAAAGGATCCCAAGACTCCCAGGGTCCAACATTAGATAACAGAGTGTTGGCCATGAACCAACCTCAAAGATTT
CCATTGAGTAGAGGACAAGCACCCTCATTTCCTCACATCTCTCCTGTCCCGTGTTCTAGGAAACCCTTCAAGTAGTTGGC
CTTCACCCACAGAACCAAGCTCCAAATCTGGTGAGTAAAGGACCCCTCTTATCTCTGCTTTTGGAAACCTGGGGAGGTGG
AAGCCTTGGATGCAAGTGTTGGCTCAAACCTCCCAGCTCTGTGAATGAGGGCCTGTCTTCCACCATCTCTGAACTCCAGA
CACTCCAACAGTGAAAGGGATCTAGGGCCACCAAAGGGCTCAGCGAAGTCTCTTTACCTTTAATTTCCTGCAGGTGAGAC
CTCCTACAAGCTAGAAGAATAATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAGTGTTTTTTCTGCCTGCATTCCTA
ACTGGAGGATAAATTCCCGGGGGCTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGTGGGTGTTTTAGAGAAGTTC
CACTTGCCAAGGAATGAATTACTGTTGGTCATCAGGCAACCCTGGCTGACTCAGCAGAGCAAGAGCCTTGCCGTAACAGA
GAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTCAGGCTGTGCAGTGTGGAAG
CTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTATTTAATTATCTTACAGTGC
TGTAGCTCAAAGCATGACGTGCATGTCACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCTTCCCTCTGAGGGTTCCAG
GCAAGAATCTGCTTCTCACTTTTCTCAGCTTCTAGAGGCTCCCATGTTCCTTGGCTCCTGGTACCCTTCCTCCTTCCTCA
AAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACCTCTTTCTCTGAATGCTG
CTCTCCCTTCTTGCCCTTCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCATCATAATCTCCCGG
AAATCATCCAGGATACCCTCCTTTTAAGTTCAGCTGACTAGCAACCATAATTCCATCTGCAATCTTCATTCCTCCTTTCA
TGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACATGGACATTTTTGGGGTGGGACAACATTCTCCTGCCTTCCAC
AAACAGTGAACAAGATGCATTTGGCCTCTGTTCTTGGGACACTGATCTTGCAGATGGTTAAATGGGAGGGCAGAAAATGT
AGGCACAAGGGGACCAATAAATGAATGATCTATTGAGAAGCATCTGTGCATGAAATCTATTTATTTATGTATTTACCTAC
TTGTTTATTGAGACGGAGCCTTGCTCTGTCGTCCAGGCTAGAGTGCAGTGGCATGATCTCGGCTCACTGCAACCTCCACC
TCCTGGGCTGAACTGATCTCCTCCCTCAGCCTCTCCAGTAGCTGGGATTACAGACCACAACCACCACGCCCGGCTAACTC
TTTTTGCATATTTTCTGTAGAGAGGATGTTTCACCATGTTGGCCAGGCTGGTCTCAAATTCCCAACCTCAGGTGATCCAA
TAGCCTCTGCCTCCCAACACGCTGGGATAAGAGGCATGAGCCACGGGGCCAAGCCAAATTTTCAAATCAATAATAGATAA
TGCTGAGTGTATGATTTCAGGTGACAGAGAAGTTCTCACTAATCAGATATTTGTGACATTAATGAAAAACACGGATTGAA
CCCCTGGAAGATTGGCAGAAGGATTTTCCACACAGCTGTCAGCCGTGAAGGCACAAAGGTGAAAACAATCTGATGTGGAA
GGAAGAGGCTCTGCCTGAAATGCCGGGAATGAGATGGGGAGAATGACAAGACGACTGTGGAGAGACGGAGAGCACACTGG
GTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCCTTGGATTCACCTCGGGGTAACCAGGAA
TCCCTACATGATTAATATGACTGACATGAAAATAAGGGAGGCTCAGGTGCATAACTGGAATCTAGGAGACCGTGGAAAAG
GCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGATGGATATAAGATATGTTTG
TGAGGTAGAATCATTGACTGGAAACGCTTACTGGGTTTAATTTTTCCTGGTAGTTTAATCCTCGCTTCACTAACTTATTT
CTGAGATTTATTTCTCCTGCATCTAAATCAATACCTGGCAGAGGAGGGAGAGCTAGATGAGGGGTGGTGCAAATGAAGGG
ACCTAGTATAGCATAATATACAAGGCTGTGAACGGTGGCTCACGCCTGTAACCCAGCACTTCAGGAGGCCAACGCGGGTG
GATCACATGAAGTCAGGAGTTCGAGACCAGCCTGGCCAACATGGAGAAACCCTATCTCTACTAAAAATACAAAAATTAAA
CAGGCATGATGGTGGTGCATGACTGTAATCCCAGCTACTCTGGAGGAGGAAGCAGGAGAATGACTTCAGCCCTGGAGGCA
GAGGTTGCAGTGAGTGGAGATCGCATCACTGCACACCAGCCTGGGCTACACAGGGATACTCTGTCTCAAAAAATAAAAAT
AAAAAATACATAAATATAATAATATACACAAATGATGCAGGCACCTGAATTCCAATCATCATTTTTCTATTCCTCTATAA
TTACTTCTTTGATCCTTTATCTTATCCATTAGAAAATCAGCCTAAAACCTCTTCCATATTTGGCTTTCTGTGAACATGAG
ATCATATGGAAAATATGAAAGCCCCCTGAACCCACCAGCACAGGCCCTGAAATAGGGAAAGTGCTCTGTTCATCACAAGA
AACTTTCCCCCTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCACCTGTGGAGATACAGATAGATCATGGGGAGGT
AAACGCTAATACTCCTTGGAGTGAGTTCAGATCTTGGAATCAGAGATCAGCACCAGCACTAGCTCCTGCTCCCCTTTCCT
ACTAATTCACAGGAGGACAGGTGGTTTTGAAGCAATAGATGGTGGAGGGGGTGGTCTTTCCCCCAGCCTCTCAGGTGGAA
CAGCAGCCTAACATGTGTCTCGCGAGATCACAAAGAGTAGCACGTTTCACATGGGCTTCATCATTATTTCCTGGCTGTTT
GACATAAGAGAATTCTACTTTGCTTTTTTGATCTTGATTTCACTTTTGTGTCCTTTTCTTGGAGAATGTAATTTGAGTCA
AGAGGGTTGTGGATGTAGAAACTGTAAAGCACATTCACTGTGTATCAATCCCAGTCCAGTCTTTCCAGAGAAGACTCTAA
ACACCTGCTGTACTGCACCTGGGCCTATGCCAATTTCTATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAAT
ACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTACATTTCAACGTGAGCCAGTCCC
TCAAGGCTCAGAAAAGCTGCTCGGGACATATGGAGTCACCTCATTTGCAGTGTATCTGGGGGAAGCCAGAAAATAGCCCA
GCCTGGGTTTTGTACCCTGAAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAA
GACAGCACAGGCTGTTCTGAGACGTTCCTCCTGATCTCAGGACGTTGCTGTCTTAGTCCATTTTTGTTGCTATAAAAGAA
CACTTGAGCCTGGGTTACTTCTTTTTTTTTTTTTTTTTTTTTTGTATAGTGCTTCTGATGAGCTTTTTTTTAAAATTTTT
ATTATTATTATACTTTAAGTTTTAGGGTACATGTGCACAATGTGCAGGTTAGTTACATATGTATACATGTGCCATGCTGG
TGTGCTGCACCCATCAACTCGTCATTTAGCATTAGGTATATCTCCTAATGCTATCCCTCCCCCCTCCCCCCACCCCACAA
CAGTCCCCAGAGTGTGATGTTCCCCTTCCTGTGTCCATGTGTTCTCATTGTTCAATTCCCACCTATAAGTGAGAACATGC
GGTGTTTGGATTTTTGTCCTTGTGATAGTCTACTGAGAATGATGATTTCCAATTTCATCCATGTCCCTGCAAAGGACATG
AACTCATCATTTTTTATGGCTGCATAGTATTCCATGGTGTATATGTGCCACATTTTCTTCATCCAGTCTATCATTGTTGG
ACATTTGGGTTGGTTCCAAGTCTTTGCTATTGTGAATAGTGCCACAATAAACATACGTGTCCATGTGTCTTTATAGCAGC
ATGATTTATAGTCCTTTGGGTTTATACCCAGTAATGGGATGGCTGGGTCAAATGGTATTTCAAGCTCTAGATCCCTGAGG
AATCGCCACACTGACTTCCACAATGGTTGAACTAGTTTACAGTCCCACCAACAGTGTAAAAGTGTTCCTATTTCTCCACA
TCCTCTCCAGCACCTGTTGTTTCCCGACTTTTTAATGATCGCCATTCTAACTGGTGTGAGATGGTATCTCATTGTGGTTT
TGATTTGCATTTCTCTGATGGCCAGTCATGGTGAGCATTTTTTCATGTGTTTTTTGGCTGCATAAATGTCTTCTTTTGAG
AAGTGTCTGTTCATGTCCTTTGCCCACTTTTTGATAGGATTGTTTGTTTTTTTCTTGTAAATTTGTTTGAGTTCATTGTA
GATTCTGGATATTAGCCCTTTGTCAGATGAGTAGGTTGCGAAAATTTTCTCCCATTTTGTAGGTTGTCTGTTCACTCTGA
TGGTAGTTTCTTTTGCTGTGCAGAAGCTCTTTAGTTTAATTAGATCCCGTTTGTCAATTTTGGCTTTTGTTGCCGTTGCT
TTTGGTGTTTTAGACATGAAGTCCTTGTCCATGCCTATGTCCTGAATGGTAATGCCTAGGTTTTCTTCTAGGGTTTTTAT
GGTTTTAGGTCTAACGTTTAAGTCTTTAATCCATCTCAAATTAATTTTTGTATAAGGTGTAAGGAAGGGATCCAGTTTCA
GCTTTCTACCTATGGCTAGCCAGTTTTCCCAGCACCATTTATTAAATAGGGAATCCTTTCCCCATTGCTTGTTTTTCTCA
GGTTTGTCAAAGATCACATAGTTGTAGATATGTGGCATTATTTCTGAGGGCTCTATTCTGTTCCATTGATCTATATCTCT
GTTTTGGTACCAGTACCATGCTGTTTTGGTTACTGTAGCCTTGTAGTATAGTTTGAAGTCAGGCAGCATGATGCCTCCAG
CTTTGTTCTTTTGGCTTAGGATTGACTTGGCAATGCAGGCTCTTTTTTGATTCCATATGAACTTTAAGGTAGTTTTTTCC
AATTCTGTGAAGAAAGTCATTGGTAGCTTGATGGGGATGGCATTGAATCTATAAATTACCTTGGGCAGTATGGCCATTTT
CACGATCTTGATTCTTCCTACCCATGAGCATGGAATGTTCTTCCATTTGTTTGTATCCTCTTTTATTTCATTGAGCAGTG
GTTTGTAGTTCTCCTTGAAGAGGTCCTTCATATCCCTTGTAAGTTGGATTCCTAGGTATTTTATTCTCTTTGAAGCAATT
GTGAATGGGAGTTCACTCATGATTTGGCTCTCTGTTTGTCTGTTATTGGTGTATAAGAATGCTTGTGATTTTTGTACATT
GATTCTGTATCCTGAGACTTTGTAGAAGCTGCTTATCAGCTTAAGGAGATTTTGGGCTGAGACAATGGGGTTTTCTATAT
ATACAATCATGTCATCTGCAAACAGGGACAATTTGACTTCCTCTTTTCCTAATTGAATACCCTTTATTTCCTTCTCCTGC
CTAATTGCCCTGGCCAGAACTTCCAACACTATGTTGAATAGGAGTGGTGAAAGAGGGCATCCCTGTCTTGTGCCAGTTTT
CAAAGGGAATGCTTCCAGTTTTTGCCCATTCAGTATGATACTGGCTGTGGGTTTGTTATAGATGGCTCTTATTATTTTGA
GATACGTCCCATCAATGCCTAATTTATTGAGAGTTTTTAGCATGAAGCGTTGTTGAATTTTGTCAAAGGCCTTTTCTGCA
TCTATTGAGATAATCGTCCGGTTTTTGTCTTTGGTTCTGTTTATATGATGGATTACATTTATTGATTTGCATATATTGAA
CCAGCCTTGCATCCCAGAGCCTGGGCAACTTCTAGAGAAAACAGATTTGTTTGCCTCACAGTTCTGCAGGCTGTACTGGA
AGCATGGCACCAGCATCTGTTTCCTGTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTG
CAGAGACCACAGAGATCACATGGCAAGAGAGGGAGCAAGGGGGAGGGCGAGCGATGGAGCTTCCAAGCTCTTTTTAACAA
CCAGCCCTCCGGGAACTAATAGAGGGGGAACTTGCTAACCCCATCATGTGGGGCAGCATTAATCTATTCATGATGGATCC
ACCTCCATGACTCAAACACCTTCCCATAGGCCCAAACTTCCACACTGGGGGTTAAATTTCAATATTTCAGTGTGAGGTTT
CAAAGGGTCAAACATCTAAACTAAAGCAGCTGTATCCTCAGCATGTTCTATGGTTTCTATGAGAGCTGTAACTGAGAAAG
CAGGAGAAAGCTGGGTCTCCCGCCATCAGGCTGCTTGTCCTAAGGAGATGTTCCATGTGGTTACCTGTCAATCAAGAAAT
GAGACAATCCATAAAGAGGAACTGCTATGATTAGCTTCTTATTGGATTCCCATCTTCCTCCAGGTATCTGCAGACACCTG
CATGTTCTGATTGGGACCTCAGTGGTCATCTTCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTTATCGCTGGTGCTCCAA
CAAAAAGAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCACGCGGGTGTG
TGTTCCTCACTGGCAGGATGGTCCCTGGCCCAAGGGAGGAGCCACAGAGGCAGGGCTTTCTAGAGAGAGCACCAGACAAC
CTGCCCCTGCCTTCAGCTCACAGACCATTGCCTGGTTCTGAACTGTATCCTCACATCCCCTGCAGCCACTGACATCCAGA
AGCTTCCATGACAGGCAGAAAGTGGGAGACAGAATCAATGGGATGCCAATTGAGAGCACTTCATGGGATGGGGTCTTGAA
CTCAGAGAGATAGAATGTCTGAGTCTGGATGTTGGCAGCTGAAGAGCCTCAGGCACCTACAGCCTCCCCCTGTGGGTTGG
TGTCTGCCCATGAAATGAGGACCCAGAAGGGCCCTCCAAGCGGTTTTGATGACTTCCGTCTCCTACAGATGCTGCTGTAA
TGGACCAAGAGCCTGCGGGGGACAGAACAGTGAATAGGCAGGTAGGTCCTCCTCGGCCCAGCCTCACGGATACAGTCTTA
TCCCTAATAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGACTCTGATGAACAAGACCC
TCAGGAGGTGACGTACGCACAGTTGGATCACTGCGTTTTCATACAGAGAAAAATCAGTCGCCCTTCTCAGAGGCCCAAGA
CACCCCTAACAGATACCAGCGTGTACACGGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTCCTGCCCACGAGCA
CCACAGTCAGGTCTTGAGGGGGTTTTCTAGGGAGACAACAGCCCTGTCTCAAAACCAGGTTGCCAGATCCAATGAACCAG
CAGCTGGAATCTGAAGGCATCAGTCTGCATCTTAGGGGATCGCTCTTCCTCACACCACGAATCTGAACATGCCTCTCTCT
TGCTTACAAATGCCTAAGGTCGCCACTGCCTGCTGCAGAGAAAACACACTCCTTTGCTTAGCCCACAAGTATCTATTTCA
CTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCCTACTTGAGGCTGCAATCACACTGAGGAACTCA
CAATTCCAAACATACAAGAGGCTCCCTCTTAACACGGCACTTACACACTTGCTGTTCCACCTTCCCTCATGCTGTTCCAC
CTCCCCTCAGACTATCTTTCAGCCTTCTGTCATCAGTAAAATTTATAAATTTTTTTTATAACTTCAGTGTAGCTCTCTCC
TCTTCAAATAAACATGTCTGCCCTCATGTGTGAGA

IPD-KIR