Allele Report for 3DL2*0010101


3DL2*0010101
Previous Designations & Local Names: NKAT4
IPD Acc No: KIR00065
Assigned: 28-JUN-2003 Sequence Last Modified: 17-JUL-2003
Source Entries: AC011501 , DQ979371 , EF103913 , L41270  
Cells Sequence Derived From: 9010 , BF1 , RDP18 , RDP3 , RDP42 , RDP55 , RDP68 , RDP77 , RDP9 , UV5HL9-5B  
Known Ethnic Origin Of Source: Caucasoid
Publications
Gedil MA et al. Tissue Antigens 70:228-32 2007. abstract
Colonna M et al. Science 268:405-8 1995. abstract
Martin AM et al. Immunogenetics 51:268-80 2000. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 10 Laboratories: 3
Protein Sequence (455 aa)
MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESF
IMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGI
SEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENV
TLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPS
SSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQ
LDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
Nucleotide Sequence Data (1368 bps)
ATGTCGCTCACGGTCGTCAGCATGGCGTGCGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACTCATGGGTGGTCAGGA
CAAACCCTTCCTGTCTGCCCGGCCCAGCACTGTGGTGCCTCGAGGAGGACACGTGGCTCTTCAGTGTCACTATCGTCGTG
GGTTTAACAATTTCATGCTGTACAAAGAAGACAGAAGCCACGTTCCCATCTTCCACGGCAGAATATTCCAGGAGAGCTTC
ATCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACAGATGTCGGGGTTCACGCCCACACTCCCTCACTGGGTGGTC
GGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGGCCCCTGC
TGAAATCAGGAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCATGTTTGAGCACTTCTTTCTGCACAGAGAGGGGATC
TCTGAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCCCTTGATGCC
TGTCCTTGCAGGAACCTACAGATGTTATGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCCCTGG
ACATCGTGATCACAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAACGTG
ACCTTGTCCTGTAGCTCCTGGAGCTCCTATGACATCTACCATCTGTCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCG
TGCAGTGCCCAAGGTCAACAGAACATTCCAGGCAGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TCGGCTCTTTCCGTGCCCTGCCCTGCGTGTGGTCAAACTCAAGTGACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCA
AGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTATCTGCAGACACCTGCATGTTCTGATTGGGACCTCAGT
GGTCATCTTCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTTATCGCTGGTGCTCCAACAAAAAGAATGCTGCTGTAATGG
ACCAAGAGCCTGCGGGGGACAGAACAGTGAATAGGCAGGACTCTGATGAACAAGACCCTCAGGAGGTGACGTACGCACAG
TTGGATCACTGCGTTTTCATACAGAGAAAAATCAGTCGCCCTTCTCAGAGGCCCAAGACACCCCTAACAGATACCAGCGT
GTACACGGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTCCTGCCCACGAGCACCACAGTCAGGTCTTGAGGGGG
TTTTCTAG
Genomic Sequence Data (17009 bps)
GTGTGAGAGGTTGGATCTGAGACGTCTTTTGAGTCTGGTCATAGTGAAGGATGCAAGGTGGCAATTGTAGTCACAACAAT
TTCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCC
TCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGC
GCGGCCTCCTGTCTGCACCGGCAGCACCATGTCGCTCACGGTCGTCAGCATGGCGTGCGTTGGTGAGTCCTGGAAGGGAA
TAGAGGGAGGGAGAGTGGGGATGGAGATCTCGGCCTAGAGGTAAAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGT
GGAGATATGGGCCTGGGTGTGGAGATATGGGCCTGGAGGTGTAAATATGGGCCTGGAGTGGAGATATGGGCCTGGAGGGG
AGATATGGGCCTGGGTGTGGAGATATGGGCCTGGAGTGGAGATACGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGA
TATGGGCCTGCAGGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGATGTGGAGATAT
GGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTAGAGGGGAGATCTGGGCCTGGAGTGGAGATATGGGT
CTGATGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATAGGGGCCTGGAGTGGAGATATGGGCCTGG
AGTGGAGATCTGGGCCAGGAAGTGTTGATCTGGGCCTGGAGCCTGGGTCTCTCCACAGCTGAGAGCCCTGTTCTTGGCAG
CAGGTAGCAGGGAGGCTAAGTTTACCTTCAGCCCAGCAAGGGCCTGGCTGCCAAGACACACAGTGCAGTGGGGGCAGCAG
GGTGCCCTGGTTTGCCTGCAGTTGGATCGTCTATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGGCC
ACTCATGGGTGAGTCCGTCCCCAAACCTTAGGGTGTCATCTCCCCACATAAGAGGATTTTTCTGAAACAGGAGGGAAGTC
CTGTCGGGGAGTCTCTCATAAACTAGGAAGAGGGGACCCTTGGATACTCGGCCCACATTTCTGACCTCGCCCTCCCTGGC
CTTTCTTTCCCTTTCCTGAGTCAAGCTCTGTGAAGACTGGGGTGAGACTGGGGTGCTCCAAGCTGGGGTGTGCAGGGAGG
AAGTGGTGTCAGCAGCAGAGAAAGAGAGGGAAGCAGTGCTAGGAACAGCAGGTCCTCTGAGGACAAAGGTATAACTGACA
CCCTCCAGCGTTTCCGTGACGGTAGGGGCTGCAGTGTGGCTGCGGTCTTTCTACCAGAAGAGGGGGGAAACCACAGCCAT
GGCCCTGACATTCCAAATCCTCTGAGGGGGCTCAGTTCATGAATTGGCTGATATTCCATTCACATAGGACATGCCCTCCA
TGCCGTGTCTACTTTGTGTTGTTTTATGTGAGTAATTTTGCAGTATTAAAATCTAGTAAGAGTCACTTATTCAGCACTTG
CTCAAAGTTCTCAGCTGACACTTGTTGTAGGGAGACGCCATGTCTATGTGGGGTGGGTCCTTCCTGTAGCCCTGGGCACC
CAGGTGTGGTAGGAGCCTTAGAAAGCGGAAATGGGAGAATCTTCTGAGCACAGGGAGGGAGGGGTGGCTCCACATCCTCC
TCTCTAAGGCAGTGCCTCCTTCTCCCCCAGGTGGTCAGGACAAACCCTTCCTGTCTGCCCGGCCCAGCACTGTGGTGCCT
CGAGGAGGACACGTGGCTCTTCAGTGTCACTATCGTCGTGGGTTTAACAATTTCATGCTGTACAAAGAAGACAGAAGCCA
CGTTCCCATCTTCCACGGCAGAATATTCCAGGAGAGCTTCATCATGGGCCCTGTGACCCCAGCACATGCAGGGACCTACA
GATGTCGGGGTTCACGCCCACACTCCCTCACTGGGTGGTCGGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGTCAG
AGGCTTTCTGTCTGGGCTTCTCACTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGGGTGTCCATCAGGGTCCCATC
ACCCAGGCCCCAACTGTATTTGGGGTCAAGGGGGATTGAATACAGGGGAAATGGGCGCTGTGGTGGGAAGAATAACTGTC
GCCAATGATGGCTACATTGTAAACCCTGGAGCCTGTGACTATTTATGTTATAGGGCAGGGGACTGAAGGGGAAGGTGGAG
CTCAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGACAGCCTGGACTGTCCTGCTGGGCTCAGTGTAATCACAAGGGTC
CGCGTGAGAGGTGGAGGAAGAGGGGAGTGGGGATTAGAGCAGTGTAGTGGGAGGGAGACGCTATCAGCCACTGTGGGCTT
TGAAGGTGGAGGAAGGCCACTAGTCACAGAATGCAGGTGGCCTCTAAGGGCTGGAGAAGTCAAGAGAACTGATTTGCTGA
GTCTCCAGAGGGAACGCAGCCCTGCAGATGCCTTGATTTCAGCACAGGGAGAACTGGATCCAATTTCTGTCCCCAGAAGT
GGAAGGGGTCAGTGTGTTCTCTCCTGCTGCCATGTTTGTGATAATTTTCTGCAGCAGCAACAGGAAACCGACACAGGAAC
CCAGGTCAAGGACAAGCTAGGAAACCAAACAAGGATAGCCAGGTGTGGTGGTGGGCACGAGTAATCCAACGACTGGGGAG
GCTGAGGCAAGATAATCACTTGAACCGGGGAGGCAGAGGTTGCAGTGAGCCAAGACAACACCACTGCACTCCAGCCTGGG
TGAAAAAGTGACTGTCTCAAAAATAAATTAATTAATCAATTAATTAAAGAAACCAAACAAGGAGAAGGTTGGCTACCGTG
GGATCAGCAAGGGTGGGATGCTGATGCCACCACCAGGCTCCATCCACATAGGAAGGGGTTGATGCTCCTGGAACCAGCAC
CAGGGACCACCCTATGGAAGCTGGGGCCATGGAGAAGGCACAGACATGGCAGGAGAGGCTCCCAATCCCCATCAGGAACA
GGGTGTGTGGACACTGATGTCTGCCTTACTGATGAGTTGATACCTCTGCCAGAGACTCCAATTTGTTCAAAAGAGATTGA
TTCAGGCTGCTGAGAGCCTGGACATGCAGCCTGTCCTCTTCCACCCCCACATAGACAGCAGGAAAGAGACTAGTGGGAAA
GAGATACAACAGCCCAAGAGATGAGGCTCTCTTCACAGTGGGAAGGGAGTCAGGGGCTACTGGAGACAGAGGGACAGAGA
AGAGGGAGGAAGACAAATGGAGGGACCTGCACCAGGGGATATGGGCACAGAAAAGACACGGAGACACAGAGAGGGAGGAG
AGAGACAGACCTCTGGGAGGGGAACCCTCACTCATTCCAGGTGCCATGGATGGGATGATAAAGAGAGATGCCTTCTAAAC
TCACAACTTCTCTTTCTAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGGCCCCTGCTGAAATCAGGAGAGAC
AGTCATCCTGCAATGTTGGTCAGATGTCATGTTTGAGCACTTCTTTCTGCACAGAGAGGGGATCTCTGAGGACCCCTCAC
GCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCCCTTGATGCCTGTCCTTGCAGGAACC
TACAGATGTTATGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCCCTGGACATCGTGATCACAGG
TGAGAGTGTCCAGACATTCTTCTCATTGTCATTGGGACACAGAGTGAATGATCCAGGACTTGGAACCCCCAGGTGGTCAT
GAGGAAGATAAGCGTGGGATTCTTATGGAGAGAGACTGACTCGGTGAGGTCTGTACCAACAGAGACAGGGAAACAGGAGA
CATAAGTACAGACCAGGTGTCATAACAGAGGACAGACACAGGGGCCATACGGGGAAGTAGAAAAGAGAGAAAGAGGTAAA
GGAGACACTCAGACAGACAGACATGTGCCAGAGAGAAGTGTCCTTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTT
AGAAGTTTCATTTCTGTTTTGTCTCCACAAAGTGCTTCTACGAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTT
GGGCCCTGTGGCCTCAGGCCTTGTGGCATCTACAGATGCCATGTTTATTCTGACACCTCTGCCTTCCATGCAGTGGAGCC
ATAATTATCCCAGGATATCATGGCCCCAGAACACCAACCCCTAAATACTGTGTGTACTTGGTGTCCCCAGACTAGATTCT
GAGGCTCATATTCCAAATAATCCTACATATAATAGGATCACTGAGAGACACAGAGATAAATCAGGGACTTCAAAAAGCAA
AGGCATAAACACACAGAGAATGAGCCAGAGGAAGGGGATTGAGAGACTCACAGACACACAAAAAGAAAGAAAAGAGGGCA
GAGGAGTGGAGAGAATGCTGGAAGGGAGGAGAGAAAAGCCCCAAAATCAGAACCCTGAGGGAGGGGCACAAAGACAGAGA
AAGATAAAGATGTGGGGATGGATTGCAGAGATTCCAAATAGAACTAGAGAGACTGAGAGGCAGAGAAAGACAAGGAGATG
GAGAGAGACAGATGATAGATGGATAGACAGATATAGATAGATGATAAATAGGTAGATGATAGATAATGGATAGGTTATAG
ATACATAGATGATGATTGATAGATGATACATAGAGATGATGATGATGATGATGAAGATAGATAGAAGACACATATATAAA
TATATAGATACATAGATGATACATAGAGACTGACAGGCAGACAGAGAGGTAATAGAGAGAGAGAGAGATGATACATAGAT
ACAGATAATACATAGATGATTGATGGATAGACAGATAGACAATTGATAGATAAATGATACATAGATATAGATGACAGATA
ATTTGTAGATAGACACAAAATAGATAGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACAAGACAGAAAGTGAGA
GACTCAGAATTATAGAAAAAGGAAGATCAAGTCAACCAATCCAAGGAGAGTCAGAGAGAATAAAACAATCCAAAAAGGGA
AAGCATACCCAGGGGTGGGGAAGTGAGGTCAGAGACCTAGAGAGACAGAGAAGGCGGAAGGAGGAAATAGACATGAAGAG
AGTTGGGGTGGAGGGTGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTATGAGGGG
AGCTGTGACAAGGAAGAACCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCTCTCAGCC
CAGCCGGGCCCCACGGTTCAGGCAGGAGAGAACGTGACCTTGTCCTGTAGCTCCTGGAGCTCCTATGACATCTACCATCT
GTCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCGTGCAGTGCCCAAGGTCAACAGAACATTCCAGGCAGACTTTCCTC
TGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGCCCTGCCCTGCGTGTGGTCAAACTCAAGT
GACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAACCCGTGTCTGTCCCATGTCTTATGATCCTAGAGCCATAGCTGAGG
AGCTTCCTGCCGATGATGGGGAGAAGCATGGACAGATGCAGAGAGAACACGAAGACTGGGTGTGAGGGGGGGGTCAGGGT
GCAGGATGGCAGACAGGGCACCTCCAAACCCTCTTGCATGGCCTGCATGGAGGCCCATGGTCAGGGCTCCAGGCACCCAG
GCAGATGGAGAAAGCGGTCAGGACAGACCCAGAGAAGGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGTTCCCTCAGC
CCCTCAACCTTACCCATTTCCCAGAAGCCCATCCTGGCCTCTCACCCACACAGAGAGATGTCATCACCAGCAACCCCTAC
ACTCTTTTCTTTTCATTTTCAAAAATATTTATTGAGGTTAAATGTAACTATATAATTTACCAACTTTACCATTTTTAAAA
GTAAAATCTAGTGGTCATAAATACCTTTATATGCTGGGTGTGGTGGTTCACGGTTGTAATCTTGGCGCTTTGAGAGGCCA
AGAAAGGTGGATCATTTAAGATCAGGGACTCGAGATCAGCCTGGCCAACATGCGGGAAATTCATCTTTACTAAACAGACA
AGAAAAATTAGCCAAGCATGCCGGCATGCACCTGTAGTCCTAGCTACTTGGGAGGCTGAGGCAGGAGAAGCACTTAAAGC
CAGGAGGCAGAGGTTGCACTGAGCCGAGATCATGCCACTGCACTGCAGCCTGGGAGACAGAGAGAGACTCTGTTTCTAAA
TAAATAAATACATCTATATTCTTTTTTTTGTTACCTTCCACCCTTCCCTTCCTGGCCTCTGGTATCCACCATTCTATTCT
CTACCTTCATGAGATCCACCTTTTATCTCCTGCATGTGGTGAGAAATGGGAATCTTTGTAATGACCTCCAGTTCCATCCA
TGTGGCTGCAAATGACAGGATGTTATTGTTTCTATGGATGAGTAGTCTCCACCGTGTGTGTGTACTACAGTTCTCTATCC
ATTCACCCACTGATAGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGGAACAGTCATATGAGTGCAG
ATATCACTTCGATACACTGATGTCCTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGACACTATGAAAGTTCTCT
TTTTTTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGTCCAAGCTGGAGTCAAAGTGGTGCGATCTTGGCTCATTG
CAACCTCTGCTTCCTAGGTTCAAACGATTCTCCTGACTCAGCCTCCCTAATAGCTGTGATTACAGGTGCACGCCACCATG
CCTGACTAATTCTTGTATTTTTTAGCACAGACGGGATATCCCAATTTTGGGCAGGCTGCTCTCAAACTCCTGACCTCAAG
TGAGGTGCCTGCCTCGGTTTCCCAAAGTGCTGAAGTTACAGGCATAAGCCACTATGCCCAGCCTCCTTTTAGTTTTTTAA
AGATTTTCCATACTTTTCTCCATAATAGTTGTACTAATTTACATTCCTACCAACAGGGTACCAGGGTTCTCCTTTCTCTA
CCATCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGATAAAAGCCATTTTACTTTACTTTATTTATTTATTTATTTATGTT
GAGATGGAGTTTCACTCATAGTCGCCCAGGCTGGAGTGCAAGGGTGTGATCTCGGCTCACTGCAACCTCTGCCTCCCGCG
TTCAACTGATTCTCCTGCCTCAGCCTCCAAAGTAGCTGGGATTACAGGCATGTGCCACCACGCCTAGCTAATTTTTGTAT
GTTTAGTAGAGAGGGAGTTTCTCCATGTTGGTCAGGCTGGTCTCCCGACCTCAGGTGATCCGCCCACCTCCGCCTCCCAA
AGTGCTGGAATTACAGGCGTGAGCCACCGGCCTAAAAGGCATTTTAATGGGATGAGATGAAAACTCATCGCGATTGTAAT
TTACATTTCTGTGATGATGAGTGATGCTGAGCACTTTTTCATATACGTGATCGCCATTTCTATGTTTTGTTTGTGGAGAA
ATGTCTCCTCATGTCTTTTGCTCGTTTTTTAATTAAATTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCCAGTTATT
AATCCCATCTCAGATGAATAGTTTGCAAATATTTGCTCCTATTTTGTGGGTTGTCTCTTCACTTTGTTGGTTTATCTTTG
GTGGTGCAGAAGTTGCTTGGTTTGATGTAATCCTAATGGTCTATTTTTTGCTTTGATTACTTGTGTTTTGAAGGTTTTAA
ACAAAATGTCTTTCATCAGACAAATGTCTTCCCCATTATTTTCTTCTACATGTTTCATAGGTTCAGGCCTTAGACTCATG
TTTTTAATCCATTTTCATTTGATTTTTGTGTAAGGTGACAGGTATAGATGCAGTTTTATTCCTCTGCATGTAGATATCCA
GTTTTCCCCACACCATTTATTGAAGACTGTCCTTTCCTGATTGTAAGTTCTCGGCACCTTTGTCAAAGTCCATTAAATGG
GCTGGGTATGGTGGCTCACACCTGCAATTCCAGCACTTTGGGAGGCCGAGGCGGGTGGATCACCTAAAGCCAGGAGTTCA
AGACCAGGCTGGCCAACAGAGTGAAACCTCGTCTCTACTAAAAATACAAAAATTAGCTGAGCATGGTGATCAGTGCCTGT
AATACCACTACTCAGGAGTTTGAAGCAAGAGAATTTCTTGAATCCAGGAAGTGGAGGTTGCATTGAGCTGAGATTGCACC
TCTACACTCCAGCCTGCATGACAGAGCAAGATTCTATCACACACACACAAAAGAAAGCCATTGGATGTAAATGCATGGAT
TATATCTGTGTTCTCCATTCTGTTCCATTTTTTATGTGCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTACTACAGC
TCTGTAACATATTTCTAAGTCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTCAAGTCTCAAGACAGTGGGCATC
GCACACAAAAATTATGGAGAAAAGGATCCCAAGACTCCCAGGGTCCAACATTAGATAACAGAGTGTTGGCCATGAACCAA
CCTCAAAGATTTCCATTGAGTAGAGGACAAGCACCCTCATTTCCTCACATCTCTCCTGTCCCGTGTTCTAGGAAACCCTT
CAAGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTGAGTAAAGGACCCCTCTTATCTCTGCTTTTGGAAAC
CTGGGGAGGTGGAAGCCTTGGATGCAAGTGTTGGCTCAAACCTCCCAGCTCTGTGAATGAGGGCCTGTCTTCCACCATCT
CTGAACTCCAGACACTCCAACAGTGAAAGGGATCTAGGGCCACCAAAGGGCTCAGCGAAGTCTCTTTACCTTTAATTTCC
TGCAGGTGAGACCTCCTACAAGCTAGAAGAATAATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAGTGTTTTTTCTG
CCTGCATTCCTAACTGGAGGATAAATTCCCGGGGGCTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGTGGGTGTT
TTAGAGAAGTTCCACTTGCCAAGGAATGAATTACTGTTGGTCATCAGGCAACCCTGGCTGACTCAGCAGAGCAAGAGCCT
TGCCGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCAGTGACTCATTCAGCCACAGCCCCATGCTCAGGCTGT
GCAGTGTGGAAGCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGTGTGAAAACAAAACGGTTATTTAATT
ATCTTACAGTGCTGTAGCTCAAAGCATGACGTGCATGTCACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCTTCCCTC
TGAGGGTTCCAGGCAAGAATCTGCTTCTCACTTTTCTCAGCTTCTAGAGGCTCCCATGTTCCTTGGCTCCTGGTACCCTT
CCTCCTTCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACCTCTTT
CTCTGAATGCTGCTCTCCCTTCTTGCCCTTCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCATC
ATAATCTCCCGGAAATCATCCAGGATACCCTCCTTTTAAGTTCAGCTGACTAGCAACCATAATTCCATCTGCAATCTTCA
TTCCTCCTTTCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACATGGACATTTTTGGGGTGGGACAACATTCT
CCTGCCTTCCACAAACAGTGAACAAGATGCATTTGGCCTCTGTTCTTGGGACACTGATCTTGCAGATGGTTAAATGGGAG
GGCAGAAAATGTAGGCACAAGGGGACCAATAAATGAATGATCTATTGAGAAGCATCTGTGCATGAAATCTATTTATTTAT
GTATTTACCTACTTGTTTATTGAGACGGAGCCTTGCTCTGTCGTCCAGGCTAGAGTGCGGTGGCATGATCTCGGCTCACT
GCAACCTCCACCTCCTGGGCTGAACTGATCTCCTCCCTCAGCCTCTCCAGTAGCTGGGATTACAGACCACAACCACCACG
CCCGGCTAACTCTTTTTGCATATTTTCTGTAGAGAGGATGTTTCACCATGTTGGCCAGGCTGGTCTCAAATTCCCAACCT
CAGGTGATCCAATAGCCTCTGCCTCCCAACACGCTGGGATAAGAGGCATGAGCCACGGGGCCAAGCCAAATTTTCAAATC
AATAATAGATAATGCTGAGTGTATTATTTCAGGTGACAGAGAAGTTCTCACTAATCAGATATTTGTGACATTAATGAAAA
ACACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTTTGCACACACAGCTGTCAGCCGTGAAGGCACAAAGGTGAAAAC
AATCTGATGTGGAAGGAAGAGGCTCTGCCTGAAATGCTGGGAATGAGGTGGGGAGAATGACAAGATGACTGTAGAGAGAC
GGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGCGTGTGTTTGACACTCACAGCCATTGGATTCACCTC
GAGGTAACCAGGAATCCCTACATGATTAATATGACTGACATGAAAATAAGGGAGGCTCAGTTGCATAACTGGAATCTAGG
AGACCGTGGAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGATGGAT
ATAAGATATGTTTGTGAGGTAGAATCATTGGCTGGAAAGGCTTGCTGGGTTTAATTTTTCCTGGTAGTTTAATCCTCGCT
TCACTAACTTATTTCTGAGATTTATTTCTCCTGCATCTAAATCAATACCTGGCAGAGGAGGGAGAGCTAGATGAGGGGTG
GTGCAAATGAAGGGACCTAGTATAGCATAATATACAAGGCTGTGAACGGTGGCTCACGCCTGTAACCCAGCACTTCAGGA
GGCCAACGCGGGTGGATCACATGAAGTCAGGAGTTCGAGACCAGCCTGGCCAACATGGAGAAACCCTATCTCTACTAAAA
ATACAAAAATTAAACAGGCATGATGGTGGTGCATGACTGTAATCCCAGCTACTCTGGAGGAGGAAGCAGGAGAATGACTT
CAGCCCTGGAGGCAGAGGTTGCAGTGAGTGGAGATCGCATCACTGCACACCAGCCTGGGCTACACAGGGATACTCTGTCT
CAAAAAATAAAAATAAAAAATACATAAATATAATAATATACACAAATGATGCAGGCACCTGAATTCCAATCATCATTTTT
CTATTCCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGAAAATCAGCCTAAAACCTCTTCCATATTTGGCTT
TCTGTGAACATGAGATCATATGGAAAATATGAAAGCCCCCTGAACCCACCAGCACAGGCCCTGAAATAGGGAAAGTGCTC
TGTTCATCACAAGAAACTTTCCCCCTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCACCTGTGGAGATACAGATA
GATCATGGGGAGGTAAACGCTAATACTCCTTGGAGTGAGTTCAGATCTTGGAATCAGAGATCAGCACCAGCACTAGCTCC
TGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTTTTGAAGCAATAGATGGTGGAGGGGGTGGTCTTTCCCCCAG
CCTCTCAGGTGGAACAGCAGCCTAACATGTGTCTCGCGAGATCACAAAGAGTAGCACGTTTCACATGGGCTTCATCATTA
TTTCCTGGCTGTTTGACATAAGAGAATTCTACTTTGCTTTTTTGATCTTGATTTCACTTTTGTGTCCTTTTCTTGGAGAA
TGTAATTTGAGTCAAGAGGGTTGTGGATGTAGAAACTGTAAAGCACATTCACTGTGTATCAATCCCAGTCCAGTCTTTCC
AGAGAAGACTCTAAACACCTGCTGTACTGCACCTGGGCCTATGCCAATTTCTATCACTCACCGTCACTCCAGGGAGACAG
AACACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTACATTTCAA
CGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTGCTCGGGACATATGGAGTCACCTCATTTGCAGTGTATCTGGGGGAAGC
CAGAAAATAGCCCAGCCTGGGTTTTGTACCCTGAAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCTCCTCC
AGGAAGAACAGGAAGACAGCACAGGCTGTTCTGAGACGTTCCTCCTGATCTCAGGACGTTGCTGTCTTAGTCCATTTTTG
TTGCTATAAAAGAACACTTGAGCCTGGGTTACTTCTTTTTTTTTTTTTTTTTTTTTTGTATAGTGCTTCTGATGAGCTTT
TTTTTAAAATTTTTATTATTATTATACTTTAAGTTTTAGGGTACATGTGCACAATGTGCAGGTTAGTTACATATGTATAC
ATGTGCCATGCTGGTGTGCTGCACCCATCAACTCGTCATTTAGCATTAGGTATATCTCCTAATGCTATCCCTCCCCCCTC
CCCCCACCCCACAACAGTCCCCAGAGTGTGATGTTCCCCTTCCTGTGTCCATGTGTTCTCATTGTTCAATTCCCACCTAT
AAGTGAGAACATGCGGTGTTTGGATTTTTGTCCTTGTGATAGTCTACTGAGAATGATGATTTCCAATTTCATCCATGTCC
CTGCAAAGGACATGAACTCATCATTTTTTATGGCTGCATAGTATTCCATGGTGTATATGTGCCACATTTTCTTCATCCAG
TCTATCATTGTTGGACATTTGGGTTGGTTCCAAGTCTTTGCTATTGTGAATAGTGCCACAATAAACATACGTGTCCATGT
GTCTTTATAGCAGCATGATTTATAGTCCTTTGGGTTTATACCCAGTAATGGGATGGCTGGGTCAAATGGTATTTCAAGCT
CTAGATCCCTGAGGAATCGCCACACTGACTTCCACAATGGTTGAACTAGTTTACAGTCCCACCAACAGTGTAAAAGTGTT
CCTATTTCTCCACATCCTCTCCAGCACCTGTTGTTTCCCGACTTTTTAATGATCGCCATTCTAACTGGTGTGAGATGGTA
TCTCATTGTGGTTTTGATTTGCATTTCTCTGATGGCCAGTCATGGTGAGCATTTTTTCATGTGTTTTTTGGCTGCATAAA
TGTCTTCTTTTGAGAAGTGTCTGTTCATGTCCTTTGCCCACTTTTTGATAGGATTGTTTGTTTTTTTCTTGTAAATTTGT
TTGAGTTCATTGTAGATTCTGGATATTAGCCCTTTGTCAGATGAGTAGGTTGCGAAAATTTTCTCCCATTTTGTAGGTTG
TCTGTTCACTCTGATGGTAGTTTCTTTTGCTGTGCAGAAGCTCTTTAGTTTAATTAGATCCCGTTTGTCAATTTTGGCTT
TTGTTGCCGTTGCTTTTGGTGTTTTAGACATGAAGTCCTTGTCCATGCCTATGTCCTGAATGGTAATGCCTAGGTTTTCT
TCTAGGGTTTTTATGGTTTTAGGTCTAACGTTTAAGTCTTTAATCCATCTCAAATTAATTTTTGTATAAGGTGTAAGGAA
GGGATCCAGTTTCAGCTTTCTACCTATGGCTAGCCAGTTTTCCCAGCACCATTTATTAAATAGGGAATCCTTTCCCCATT
GCTTGTTTTTCTCAGGTTTGTCAAAGATCACATAGTTGTAGATATGTGGCATTATTTCTGAGGGCTCTATTCTGTTCCAT
TGATCTATATCTCTGTTTTGGTACCAGTACCATGCTGTTTTGGTTACTGTAGCCTTGTAGTATAGTTTGAAGTCAGGCAG
CATGATGCCTCCAGCTTTGTTCTTTTGGCTTAGGATTGACTTGGCAATGCAGGCTCTTTTTTGATTCCATATGAACTTTA
AGGTAGTTTTTTCCAATTCTGTGAAGAAAGTCATTGGTAGCTTGATGGGGATGGCATTGAATCTATAAATTACCTTGGGC
AGTATGGCCATTTTCACGATCTTGATTCTTCCTACCCATGAGCATGGAATGTTCTTCCATTTGTTTGTATCCTCTTTTAT
TTCATTGAGCAGTGGTTTGTAGTTCTCCTTGAAGAGGTCCTTCATATCCCTTGTAAGTTGGATTCCTAGGTATTTTATTC
TCTTTGAAGCAATTGTGAATGGGAGTTCACTCATGATTTGGCTCTCTGTTTGTCTGTTATTGGTGTATAAGAATGCTTGT
GATTTTTGTACATTGATTCTGTATCCTGAGACTTTGTAGAAGCTGCTTATCAGCTTAAGGAGATTTTGGGCTGAGACAAT
GGGGTTTTCTATATATACAATCATGTCATCTGCAAACAGGGACAATTTGACTTCCTCTTTTCCTAATTGAATACCCTTTA
TTTCCTTCTCCTGCCTAATTGCCCTGGCCAGAACTTCCAACACTATGTTGAATAGGAGTGGTGAAAGAGGGCATCCCTGT
CTTGTGCCAGTTTTCAAAGGGAATGCTTCCAGTTTTTGCCCATTCAGTATGATACTGGCTGTGGGTTTGTTATAGATGGC
TCTTATTATTTTGAGATACGTCCCATCAATGCCTAATTTATTGAGAGTTTTTAGCATGAAGCGTTGTTGAATTTTGTCAA
AGGCCTTTTCTGCATCTATTGAGATAGTCGTCCGGTTTTTGTCTTTGGTTCTGTTTATATGATGGATTACATTTATTGAT
TTGCATATATTGAACCAGCCTTGCATCCCAGAGCCTGGGCAACTTCTAGAGAAAACAGATTTGTTTGCCTCACAGTTCTG
CAGGCTGTACTGGAAGCATGGCACCAGCATCTGTTTCCTGTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGG
AGGGTCTGTCTGTGCAGAGACCACAGAGATCACATGGCAAGAGAGGGAGCAAGGGGGAGGGCGAGCGATGGAGCTTCCAA
GCTCTTTTTAACAACCAGCCCTCCGGGAACTAATAGAGGGGGAACTTGCTAACCCCATCATGTGGGGCAGCATTAATCTA
TTCATGATGGATCCACCTCCATGACTCAAACACCTTCCCATAGGCCCAAACTTCCACACTGGGGGTTAAATTTCAATATT
TCAGTGTGAGGTTTCAAAGGGTCAAACATCTAAACTAAAGCAGCTGTATCCTCAGCATGTTCTATGGTTTCTATGAGAGC
TGTAACTGAGAAAGCAGGAGAAAGCTGGGTCTCCCGCCATCAGGCTGCTTGTCCTAAGGAGATGTTCCATGTGGTTACCT
GTCAATCAAGAAATGAGACAATCCATAAAGAGGAACTGCTATGATTAGCTTCTTATTGGATTCCCATCTTCCTCCAGGTA
TCTGCAGACACCTGCATGTTCTGATTGGGACCTCAGTGGTCATCTTCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTTAT
CGCTGGTGCTCCAACAAAAAGAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGG
AGCACGCGGGTGTGTGTTCCTCACTGGCAGGATGGTCCCTGGCCCAAGGGAGGAGCCACAGAGGCAGGGCTTTCTAGAGA
GAGCACCAGACAACCTGCCCCTGCCTTCAGCTCACAGACCATTGCCTGGTTCTGAACTGTATCCTCACATCCCCTGCAGC
TACTGACATCCAGAAGCTTCCATGACAGGCAGAAAGTGGGAGACAGAATCAATGGGATGCCAATTGAGAGCACTTCATGG
GATGGGGTCTTGAACTCAGAGAGATAGAATGTCTGAGTCTGGATGTTGGCAGCTGAAGAGCCTCAGGCACCTACAGCCTC
CCCCTGTGGGTTGGTGTCTGCCCATGAAATGAGGACCCAGAAGGGCCCTCCAAGCGGTTTTGATGACTTCCGTCTCCTAC
AGATGCTGCTGTAATGGACCAAGAGCCTGCGGGGGACAGAACAGTGAATAGGCAGGTAGGTCCTCCTCGGCCCAGCCTCA
CGGATACAGTCTTATCCCTAATAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGACTCT
GATGAACAAGACCCTCAGGAGGTGACGTACGCACAGTTGGATCACTGCGTTTTCATACAGAGAAAAATCAGTCGCCCTTC
TCAGAGGCCCAAGACACCCCTAACAGATACCAGCGTGTACACGGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCT
CCTGCCCACGAGCACCACAGTCAGGTCTTGAGGGGGTTTTCTAGGGAGACAACAGCCCTGTCTCAAAACCAGGTTGCCAG
ATCCAATGAACCAGCAGCTGGAATCTGAAGGCATCAGTCTGCATCTTAGGGGATCGCTCTTCCTCACACCACGAATCTGA
ACATGCCTCTCTCTTGCTTACAAATGCCTAAGGTCGCCACTGCCTGCTGCAGAGAAAACACACTCCTTTGCTTAGCCCAC
AAGTATCTATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCCTACTTGAGGCTGCAATCA
CACTGAGGAACTCACAATTCCAAACATACAAGAGGCTCCCTCTTAACACGGCACTTACACACTTGCTGTTCCACCTTCCC
TCATGCTGTTCCACCTCCCCTCAGACTATCTTTCAGCCTTCTGTCATCAGTAAAATTTATAAATTTTTTTTATAACTTCA
GTGTAGCTCTCTCCTCTTCAAATAAACATGTCTGCCCTCATGGTTTCGA

IPD-KIR