Allele Report for 3DL1*063


3DL1*063
Previous Designations & Local Names: FH08_BA2X
IPD Acc No: KIR00455
Assigned: 28-AUG-2009 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182343  
Cells Sequence Derived From: FH08  
Known Ethnic Origin Of Source: Black
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (444 aa)
MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYHHRFNNFMLYKEDGIHIPIFHGRIFQESF
NMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGI
SKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTSYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESV
TLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYELSDPSDPLLVSVTGNPS
SSWPSPTEPSSKSGNPRHLHVLIGTSVVIILFILLLFFLLHLWYSNKKNAAVMDQEPAGNRTANSEDSDEQDPQEVTYAQ
LDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP
Nucleotide Sequence Data (1335 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTGTTCTTGGTCCAGAGGGCCGGTCCACACATGGGTGGTCAGGA
CAAACCCTTCCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACACGTGACTCTTCGGTGTCACTATCATCATA
GGTTTAACAATTTCATGCTATACAAAGAAGACGGAATCCACATTCCCATCTTCCATGGCAGAATATTCCAGGAGAGCTTC
AACATGAGCCCTGTGACCACAGCACATGCAGGGAACTACACATGTCGGGGTTCACACCCACACTCCCCCACTGGGTGGTC
GGCACCCAGCAACCCCGTGGTGATCATGGTCACAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGG
TGAAATCAGGAGAGAGAGTCATCCTGCAATGTTGGTCAGATATCATGTTTGAGCACTTCTTTCTGCACAAAGAGGGGATC
TCTAAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAATTTCTCCATCGGTCCCATGATGCT
TGCCCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACACCTCCTATCAGTTGTCAGCTCCCAGTGATCCCCTGG
ACATCGTGGTCACAGGTCCATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCAAGGTTCAGGCAGGAGAGAGCGTG
ACCTTGTCCTGTAGCTCCCGGAGCTCCTATGACATGTACCATCTATCCAGGGAGGGGGGAGCCCATGAACGTAGGCTCCC
TGCAGTGCGCAAGGTCAACAGAACATTCCAGGCAGATTTCCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TTGGCTCTTTCCGTCACTCTCCCTACGAGTTGTCAGACCCGAGTGACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCA
AGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTAACCCCAGACACCTGCATGTTCTCATTGGGACCTCAGT
GGTCATCATCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTCATCTCTGGTACTCCAACAAAAAAAATGCTGCTGTAATGG
ACCAAGAGCCTGCAGGGAACAGAACAGCCAACAGCGAGGACTCTGATGAACAAGACCCTCAGGAGGTGACATACGCACAG
TTGGATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGACACCCCCTACAGATACCATCTT
GTACACGGAACTTCCAAATGCTAAGCCCAGATCCAAAGTTGTCTCCTGCCCATGA
Genomic Sequence Data (14564 bps)
GTTCGGGAGGTTGGATCTGAGACGTGTTTTGAGTTGGTCATAGTGAAGGACGCGAGGTGTCAATTCTAGTGAGAGCAATT
TCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCCT
CCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCG
CGGCCGCCTGTCTGCACCGGCAGCACCATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAAT
CGAGGGAGGGAGTGCGGGGATGGAGATCTGGACCTGGAGGTAAAGATATGGGCCTAGAGGTGGAGTTATGGGCCTAGAGG
TGGAGTTATGGGCCTGAAGTGGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGA
GATAGGGGCCTGGGGTGGAGATATGTGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATA
TGTGCCTGGGGTGGAGAGATGGGCCTGGAGGGGAGATATGGGCCTGGAGGGGAGATGTGGGCCTAGAGGTGGAGTGATGG
GCCTAGAAGTGGAGCGATGGGCCTGGAGTGGAGATATGGGCCTGGAGGTGGAGTTAGGGGCCTGCAGTAGAGATATGGGC
CTGAAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTAGAGGTGGAGTTATGGGCCCGGAGGTGGAGTTAAGGGCAT
GAAGTGGAGATCTGGGCCTGGAGTGGAGATATGATCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATACGGGCCTGGAG
CAGACATACAAGCCTGGAAAGGAGATATGGGCCTGGAGAGGAGATAGAAGCCTGGAGTGGAAATATGGGCCTGGAGTGGA
GATATGAGCCTGGAGTGGATATATGAGCCTGGAGTTGAGATAGGAGCCTGGAGTGGAGATATGGGCCTGGAGTGGACTTA
CCAGCCTGGAGAGGAGATATGGGCCTGGAGTGGAGATACGGACCTGGAGTGGAGATCTGGGCCTGTTGTGTAGATCTAGG
CCTGGAGGTAGAGATCTGGGCCTGGAGGCTCAGTCTCTGCACAGCCGAGATCCTTGTTCCTGGGGGCAGGTAGGCAGCGA
GGGTGAGTTTACCTTCAGCCCAGCAAGGGCCTGGCTGCCAAGACGCACAGCCCAGTGGGGGCAGCAGGGTGCCCTGGTTT
GCCTGCAGATGGATGGTCCATCATGATCTTTCTTTCTAGGGTTGTTCTTGGTCCAGAGGGCCGGTCCACACATGGGTGAG
TCCTTCCCCAAACCTTAGGGTGTCATCTCCCCACATAAGAGGATTTTCCTGAAATGGGAGGGAAGTCCTGTCGGGGAGTC
TCTCATACACTAGGAAGAGGGGACCCTCGGATGCTCGGCCCACATTTCTGACCTTGCCTTCCCCGGCCTTTCATTCCCTT
TCCTGAGTCAAGCTCTGTGAAGACTGGGGTGAGACTAGGGTGCTCCAAGATGGGTGTGCAGGGAGGAAGTGGTGTCAGCA
GCAGAGAAAGAGAGGGAAGCAGTGCTAGGAACAGCAGGTCCTCTGAGGACAAAGGTGTAACTCACACCCTCCAGCGTTTC
CGTGATGGTAGGGGCTGCAGTGTGGCTGCGGTCTTTCTACCAGAAAAGGTGAGGAAACCACAGCCATGGCCCTGACATTC
CAAATCCTCTGATGGGGGCTCAGTTCATCAATTGGCTGATATTCCATTCACATAGGACTTGCCCTCCATGCCGTGTCTAC
TTTGTGTTGTTTTATATGAGTAATTTTGCAGTATTAAAATCTAGTAAGAGTTGCTTCTCCAGCAACTTGCTCAAAGTTCT
CAGCTGACACTTGTTGTAGGGAGACGCCAAGTCTATGCAGGATGGGTCCTTCCTGTAGCCCTGGGCACCCAGGTGTGGTA
GGAGCCTTAGAAAGTGGAAATGGGGAGAATCTTCTGGGCACTGGGAGTGAGGGGCGGCTCCACATCCTCCTCTCTAAGGC
AGTGCCTCCTTCTCCCCCAGGTGGTCAGGACAAACCCTTCCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGAC
ACGTGACTCTTCGGTGTCACTATCATCATAGGTTTAACAATTTCATGCTATACAAAGAAGACGGAATCCACATTCCCATC
TTCCATGGCAGAATATTCCAGGAGAGCTTCAACATGAGCCCTGTGACCACAGCACATGCAGGGAACTACACATGTCGGGG
TTCACACCCACACTCCCCCACTGGGTGGTCGGCACCCAGCAACCCCGTGGTGATCATGGTCACAGGTCAGAGGCTTTCCG
TCTGGGCTTCTCACTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGGGTGTCCGTCAGGGTCCCATCACCCAGGCCC
TGACTGTATTTGGGGTCAAGGGAGATTGAATACAGGGGAAATGGGTGCTGTGGTGGGAAGAATCACTGTCCCCAATGATG
GCTACATTGTAATCCCTGGAGCCTGTGACTATTTATGTTACAGGGCAGGGGACTGAAGGGGAAGGTGGAGCTCAGGTTGT
TGATGAGTTGACCTTGAGATGGGGAGACAGCCTGGACTGTCCCACTGGGCTCAGTGTAATCACAAGGGTCCACATGAGAG
GTGGAGGAAGAGGGGAGTGGGGATTAGAGCAGTGTAGTGGGAGGGAGACGCTATCAGCCACTGCGGGCTTTGAAGGTGGA
GAAAGACCACTAGTCACAGAATGCAGGTGGCCTCTAAGGGCTGGAGAAGTCAAGAGAACTGATTCGCTGATTCTCCAGAG
GGAACGCAGCCCTGTAGACACCTTGATTTCAGCACAGGGAGAACTGGATCCAATTTCTGTCTCCAGAAGTGGAAGGGGTC
AGTGTGTTCTCTCCCGCTGCCATGTTTGTGGTAATTTTCTGCAGCAGCAACAGGAAACCAACACAGGAACCCAGGTCAAG
GACAAGTTAGGAAACCAAACAAGGATAGCCAGATGTGGTGGTGGGCGCGAGTAATCCAACGACTGGGGAGGCTGAGGCAA
GAGAATCACTTGAACTGGGGATTTGTTCAAAAGAGATTGATTCAGGCTGCTGAGAGCCTGGACATGCAGCCTGTCCTCTT
CCACCCCCACATAGACAGCAGGAAAGAGATTAGTGGGAAACAGATACAACAGCCCAAGAGATGAGGCTGTCTTCACAGTG
GCAAGGGAGTCAGGGGCTACTGGAGACAGAGGGACAGAGAAGAGGGAGGAAGACAGATGGAGGCACCTGCACCAGGGGAT
ATGGGCACAGAAAAGACACGGAGATGCAGAGAGGGAGGAGAGAGACAGACACGGGGAGGGGAACCCTCACTCATTCCAGG
TGCCATGGATGGGATGATAAAGAGAGATGCCTTCTAAACTCACAACTTCTCTTTCTAGGAAACCACAGAAAACCTTCCCT
CCTGGCCCACCCAGGTCCCCTGGTGAAATCAGGAGAGAGAGTCATCCTGCAATGTTGGTCAGATATCATGTTTGAGCACT
TCTTTCTGCACAAAGAGGGGATCTCTAAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAAT
TTCTCCATCGGTCCCATGATGCTTGCCCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACACCTCCTATCAGTT
GTCAGCTCCCAGTGATCCCCTGGACATCGTGGTCACAGGTGAGAGTGTCTAGACATTGTTCTCATTGTCACTGGGACACA
GAGTGAATGATCCAGGACTTGGAACCCCCAGGTGGTCATGAGGAAGATAAGTGTGGGATTCTTACGGAAAGAGAGTGACT
TGGTGAGGTCTGTACCAACAGAGACAGAGAAACAGCAGACATAAGTACAGAACAGGTGTCATAACAGAGGACAGACACAG
GGGCCATACAGGGAGGTAGAAAAGAGAGAAAGAGGTAAAGGAGACACTCAGACAGACAGACATGTCCCAGAGAGAGGTGT
CCTTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTGTTCCTAC
CAGAAGAACCCAAGGACACCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGCCACCTACAGATGCCG
TGTTTATTCTGACACCTCTGCCTTCCATGCAATGGAGAGTAATCATCCCAGGATATCATGGCCCCTGAACACCAACCCCT
GTATGCTGTGTGAACTTGGGGTCCCCAGACTGGATTCTGAGGCTCATATTCCAAATAATCCCACATATGATAGGATCGCT
GAGAGACACAGAGAAAAATCAGGGACACCAAAAAGCAAAGACATAAACACACACAAAATGAGCCAGAAGAAGGAGATTAA
GAGATTCACAGACACATAAAAAGAAAGAAAAGAGGGCAGAGTGGAGAGAATGATGGAAAGGAGGAGAGAAAAGCCCCAAA
ATCAGAACCCTGAGGGAGGGACACAAAGACAGAGAAAGATAAATATGTGGGGATGGATTGCAGAGATTCCAAATAGAACT
AGAGAGACTGAGAGGCAGAGAAAGACAAGGAGACGGAGAGAGAGAGATGATAGATGGATAGATAGACGTAGATAGATGAT
AAATAGGTAGATGATAGATAATGGATTGGTTATAGATACATAGATGATGACTGATAGATGATACATAGAGATGACGATGA
TGATGATAGACACGTAGATATATACATAGATGATACATAAATAGAGACAGAGAGGCAGACAGAGAGGTAATAGAGAGAGA
GATAGATGATACATATATAGATAATAGATGATTGATGGATAGATAGACAGATAGACAATTGATAGAGAGATAGATAAGTG
ATACATAAATATAGATGATAGATAATTTGTAGATAGACACAAAATAGATAAATAGATAGAAATGTGCAGAAAGTTATGAA
CAAGACAGAAAGTGAGAGACTCAAAATTAAAGAAAAAGGAAGATCAAGTCAACCAATCCAAGGAGGGTCAGAGAGAATAA
AACAATCCAAAAAGGGAAAACATACCTCAGGGTGGGGAATTGAGGTCATAGACCTAGAGAGACAGAAAAGGTAGAAGGAG
GAAACAGATATGAAGAGAGATGGGGTGGAGGGTGAGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTC
TCAGCTCAGGTATGAGGGGAGCTATGACAAGGAAGAACCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCCATATGA
GAAACCTTCTCTCTCAGCCCAGCCGGGCCCCAAGGTTCAGGCAGGAGAGAGCGTGACCTTGTCCTGTAGCTCCCGGAGCT
CCTATGACATGTACCATCTATCCAGGGAGGGGGGAGCCCATGAACGTAGGCTCCCTGCAGTGCGCAAGGTCAACAGAACA
TTCCAGGCAGATTTCCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTTGGCTCTTTCCGTCACTCTCCCTA
CGAGTTGTCAGACCCGAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGAAAAGCCCATATCTCTCTCATGTCCTATGAT
CCTAAATCCTTAGCTAAGGAGCTTCCTGCTGATGATGGAGAAAAGCATGGACAGATGCAGAGAGAAGACACAGCAGGTGT
GAGGGCGGAGTCAGGGCGCAGGATGGCAGACAGGGCACCTCCAAACCCTCCTTCATGGCCTGCATGGAGGCCTCCGATCA
GGGCTCCAGGCACCCAGGCAGATGGAGAAAGCGGTCAGGACAGACCCAGAGAAGGGGAGACTGGGCTTAGTTTGGGGAGA
TCAGAGGTTCCCTCAGCCCCTCAATCTTATCCATTTCCCAGAAGCCCATCATGGCCTCTCACCCACACAGAGAGATGTCA
TCACCAGCAACCCCTACACCCTTTTCTTTTCATTTTCAAAAATATTTATTGAGGTTAAATGTAACTATATAATTTACCAA
CTTTACCATTTTTAAAAGTAAAATCTAGTGGTCATAAATACCTTTATATGCTGGGTGTGGTGGTTCACGGTTGTAATCTC
GGCGCTTTGAGAGGCCAAGGAAGGTGGATCATTTAAGATCAGGAACTCGAGATCACCCTGGCCAACATGTGGGAAATTCA
TCTTTACTAAACAGACAAGAAAAATTAGCCGAGCATGCCGGCATGCACCTGTAGTCCTAGCTACTTGGGAGGCTGAGGCA
GGAGAAGCACTTAAAGCCAGGAGGCAGAGGTTGCACTGAGCCGAGATCATGCCACTGCACTGCAGCCTGGGAGACAGAGA
GAGACTCTGTTTCTAAATAAATAAATACATCTATATTCTTTTTTTTGTTACCCTCCACCCTTCCCTTCCTGGCCTCTGGT
GTCCACCATTGTATTCTCCACCTTCATGAGATCCACCTTTTATCTCCTTCATGTGGTGAGAAATGGGAATCTTTGTAATG
ACCTCCAGTTCCATCCATGTGGCTGCAAATGACAGGATGTTATTGTTTCTATGGATGAGTAGTCTCCACTGTGTGTGTGT
ACTACAGTTCTCTATCCATTCACCCACTGATAGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGGAA
CAGTCATATGAGTGCAGATATCACTTCGATACACTGATGTCCTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGA
CACTATGAAAGTTCTCTTTTTTTTTTTTTCCTTTTTTGAGAAAGAGTTTCCCTCCTTAGTCCAAGCTGGAGTCTAAGTGG
TGAGATCTTGGCTCATTGCAACCTGTGCCTCCTAGGTTCAAATGATTGTCCTGACTCAGCCTCCCTAGTAGCTGTGATTA
CAGGTGCACGCCACCATGCCTGGCTAATTTTTGTATTTTTTTAGCACAGACGGGATATCCCAATTTTGGGCAGGCTGCTC
TCAAACTCCTGACCTCAAGTGAGGTGCCTGCCTCGGTTTCCCAAAGTGCTGAAGTTACAGGCATAAGCCACTATGCCCAG
CCTCCTTTTAGTTTTTTAAAGAATTTCCATACTTTTCTCCATAATAGTTGTACTAATTTACATTCCTACCAACAGGGTAC
CAGGGTTCTCCTTTCTCTACCATCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGTAAAAGCCATTTTACTTTACTTCATT
TTATTTATTTATTTATGTTGAGATGGAGTTTCACTCATAGTCGCCCAGGCTGGAGTGCAAGGGTGTGATCTCAGCTCACT
GCAACCTCCGCCTCCCGCGTTCAACTGATTCTCCTGCCTCAGCCTCCAAAGTAGCTGGGATTACAGGCATGTGCCACCAC
GCCTAGCTAATTTTTGTATGTTTAGTAGAGAGGGAGTTTCTCCATGATGGTCAGGCTGGTCTCCCGACCTCAGGTGATCC
GCCCACCTCCGCCTCCTGAAGTGCCGGAATTACAGGCGTGAGCCACCGGCCTAAAAGGCATTTTAATGGGATGAGATGAA
AACTCATCGCGATTGTAATTTACATTTCTCTGATGATGAGTGATGCCGAGTACTTTTTCATATACGTGATCGCCATTTCT
ATGTTTTGTTTGTGGAGAAATGTCTCCTCATGTCTTTTGCTCTTTTTTTGAATTAAATTGTTTTATTGAGTTGTTTGAGC
TTCTTATATTTCCAGTTATTAATCCCGTCTCAGATGAATAGTTTGCAAATATTTGCTCCTATTTTGTCGGTTGTCTCTTC
ACTTTCTTGGTTTATCTTTTGTGGTGCAGAAGTTGCTTGGTTTGATGTAATCCTAATGGTCTATTTTTTGCTTTGATTAC
TTGTGTTTTGAAGGTTTTAAACAAAATGTCTTTCGTCAGACAAATGTCTTCCCCATTATTTTCTTCTACATGTTTCATAG
GTTCAGGCCTTAGACTCATGTTTTTAATCCATTTTCATTTGATTTTTGTGTAAGGTGACAGGTATAGATGCAGTTTTATT
CCTCTGCATGTAGATATCCAGTTTTCCCCACACCATTTATTGAAAAGACTGTCCTTTCCTGATTGTAAGTTCTCGGCACC
TTTGTCAAAGTCCATTAAATGGGCTGGGTATGGTGGCTCACACCTGCAATTCCAGCACTTTGGGAGGCCGAGGCGGATGG
ATCACCTGAAGCCAGGAGTTCAAGACCAGGCTGGCCAACAGAGTGAAACCTCGTCTCTACTAAAAATACAAAAATTAGCT
GAGCATGGTGACCAGTGCCTGTAATACCACTACTCGGGTGTTTGAGGCAAGAGAATTGCTTGAATCCAGGAAGTGGAGGT
TGCATTGAGCTGAGATTGCACCTCTGCACTCCAGCCTGCATGACAGAGCAAGATTCTATCACACACACACAAAAAAAAAG
CCATTGGATGTAAATGCATGGATTATATCTGTGTTCTCCATTCTGTTCCATTTTTTATGTGCCTTTCTTTATGCCAATGT
CATGCTGTTTTGCTTACTACAGCTCTGTAACATATTTCTAAGTCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTT
CAAGTCTCAAGACAGTGGGCATCGCACACAAAAATTATGGAGAAGAGGATCCCAAGACTCCCAGGGTCCAACATTAGATA
ACAGAGTGTTGGCCATGAACCAACCTCAAAGATTTCCATTGAGTAGAGGACAAGCACCCTCATTTCCTCACATCTCTCCT
GTCCCGTGTTCTAGGAAACCCTTCAAGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTGAGTAAAGGACCC
CTCTTATCTCTGCTTTTGGAAACCTGGGGAGGTGGAAGCCTTGGATGCAAGTGTTGGCTCAAACCTCCCAGCTCTGTGAA
TGAGGGCCTGTCTTTCACCATCTCTGAACTCCAGACACTCCAACAGTGAAAGGGATCTAGGGCCACCAAAGGGCTCAGCG
AAGTCTCTTAACCTTTAATGTCCTGCAGGTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCA
GGAAACATGCAGTGTTTTTTCTTCCTGCATTCCTAACTGGAGGATAAATTCCTGGGGACTTGAGAGAGGGAAGGGAAGGG
AACATCTGATGAGGGCGAGGTGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAATTACTGTTGGTCATGAAGCAACCCTG
GCTGACTCAGCAGAGCAACAGCCTTGCCGTAATAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCA
GCCACAGCCCCATGCTCAGGCTGTGCAGTTGGAATCCTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGT
GAAAACAAAGCGGCTTTTTAATTATCTTACAGTGCTGTAGCTCAAAGTATGAAGTGCATCTCACTGGGCTAAAAACAAGG
TGACAGCAAGGCTGCCTTCCCTTGCCTGAGGATTCCAGGCAAGAATCTGCTTCTCACTTGTCCCATCTTATAAAGGCTCC
CAGTTCCTTGGCTCCTGGTCCCCTTCCTCCTTCCTCAAAGCCCACAAAGGCTGGTCACATCTCACATGGCATCACTCAGA
CCCTTCTTCCTTACCACACCTCTTTCTCTGAATGCTGCTCTCCCTTCTTCCTTATCTTTTGAAAACTTGGGGATTCTATT
GGGTTCACCAAGATGAAAATCCATCATAATCTCCTGGAAATCATTCAGGATACCCTTGTTTTAAGTTCAGCTGACTAGCA
ACCGTAATTCCATCTGCAATCTTCATTCCTTCTTTCCATGTAAAATAACATATTCACAAGCTATGGAGGCCAGGACAGGG
ACATTTTGGGGTGGGACAGCATTCTCCTGCCTTCCACGAACGGTGAACAAGATGCATTTGGCCTCTGCTCTTGGGACACT
GATATTGCAGATGGTTAAATGGGAGGGCAGAAAATGAATGCACAAGTGGACCAATAAATGAATGATCCATTGGGAAGCAT
CTGTGTATGAAATCTATTTGTTTGTTCGTTCATTTATTTATTGAGACAGAGTCTCCCTCTGTCTTCCAGGCTACAGTGCA
GTGTCACGATCTTGGCTCACTGCAACCTGCGTCTCCTGGATCCAAGTGATTCTCCTGCCTCACCCTCTCGAGTAGCTGGG
ATTACAGGCAACTGCCACCATGCCCGGCTAATTCTTTTTGTATATTTTTTGTAGAGAGGATGTTTCACCATATTGGCCAA
GCTTGTCTGAAACTCCCAACCTCAAGTGATCCGACCATCTCAGCAACCCAAAGTACTGGGATTACAGGCGTGAGCCACTT
TGCCCAGCCAGAATTCAAAATAAATAATAGATAATGCTGAGTGTATAATTTTGGGTGACAGAGAAGGTCTCACTAATCAG
ATATTTGTGACATTAATGAAAAACACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTTTCCACACAGCTGTCAGCTGT
GAAGGCACAAAGGTGAAAACAATCTGATGTTGAAGGAAGAGGCTCTGACTCAAATGCTGGGAATGAAGTGGGGAGAATGA
CAAGACGACTGTGGAGAGACGGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTC
ACAGCCATTGGATTCACCTCGGGGTAACCAGGAATCCCTACATGATTAATATGACTGACATGAAAATAAGGGAGGCCCAG
GTGCGTAACTGGAATCTAGGAGACCGTGGAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACCCTA
AGTGGATGAAGCAGATGGATATAAGCTATGTTTGGGAGGTAGAATCATTTGCAGGGAGGGCTTGCTGGGTTTGAGTTTCC
TAGTTGTTTAATCCTTGCTAAATTAATTTCTTTCTGAGATTTATTCCTCCTACACATAAATCAATACCTGGCAAAGGAGT
GACAGATATATGAGGGGTGGTGGAAATGAAGGGACCTATTATAGCATAATATACAAGTCTGTGAACGGTGGCTCACTCCT
GTAACCCAGCACTGCAGGAGGCTAAGGCCAGTGGATTCCAAGAAATCAGGAGTTCGAGACCAGCCTGGCCAACATGGTGA
AACCCTATCTCTACATGGTGAAACCCTATCTCTCCTAAAAATACAAAAATTAGCCGAGCATGGTGGTGCATCCCTGTAAT
CCCAGCTCCTGCTCTGGAGGATGAAGCAGGAGAATGACTTCAACCCAGGAGGTGGAGGTTGCAGTGAGTGGAGATCGCAT
CACTGCACTCCAGCCTGGGTGACACAAGGAGACTCCATCTCAAAAAATAAAAATAAGAAATGCATAAATATAATAAAACA
CACACGAATGACAAAGGCACCTGAATTCCCATCATCATTTTTCTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTA
TCCATTAGGCAATCAGCCTAAAACCTCTTCCGTATTTGGCTTTCTGTGAGCATGAGATCATATAGAAAATGTGAAAGCCC
GCTGAATCCTCCAGCACAAATCCTGGAATAGAGAAAGTGCTCTGGTCATCACAAAAAAAACTTGCCCCCTCACCCAAATC
CCCCACCTCACCCCTACTTCCAATCACCTGTGGAGATACAGATAGATCATGGGGAGGTAAATGCTCATACTCCTTGGAGT
GAGTCCAGATCTTGGAATCAGAGATCTGTCCCAGCACTAGCTCCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGT
GGTATTGAAGCAATAGATAGTCGAGGGGGTGGTCCTTCCCCCAGCCTCTCAGGTAGAACAGCAGCCTAACATGTGTCTCC
CGAGATCACAAAGAGTAGCACATTTCACACGGGCTTCAACACTATTTTCTGGCTGTTTGACATAAGAGAATTCTACTTCG
CTTTTTTTATATTGATTTCACTTTTGTTTCCTTTTCTTGGAGAATGCAAGTTGTTTAACTCAAGAATGCCGTGGATGTAG
AAATCCTAAAGCACATTCGCTGTGTATCAATCCCAGTCCAGTCTTCCCAGAGAAGACTCTAAACACCTCCTGGACTGCAC
CTGGGCCTATGCCAATTCCTATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAATACGTTACATAGGCAGGTT
CATTACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTACATTTCAATGTGAGCCAGTTCCCCAAGGCTCAGAAAAGCT
GCTCGAGACATGTGGAGTCACCCCATTTGCAGTGTAGCTGGGGGAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTACCCT
GGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCT
GGGACGATCCTCCTGATCTCAGGACTTTGCTGTCTTAGTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGGGTAAC
TTCTAAAGAAGAGATTGGTTTGCCTCACCATTCTGCAGGCTGTACTGGAAGCATGGCACCAGCATCTATTTCTTATGATG
GCCTCAGGCCGCTCCCACTCTGGCAGAAGGGAAGGAGAGTCTGTCTGTGCAGAGACCACAGAGATCACACGGCAAGAGAG
GGAGCAAGGGGGAGGGGGAGCAATGGAGCTTCCAAGCTCTTTTTAACAACCAGCTCTCCAGGAACTAATAGAGAGGGAAC
TTGCTAACCCCGTCTCCTTGGGACAGCATTGATCTGTTCATGATGGATCCACCTCCATGACCCAAACACCTCCCAAGAGG
CCCAACCTCCCACACTGGGGGTTAAATTTCAATGTGAGGTTTGAAGGGGTCAAACATCTCAACTAAAGTAGTTGTATCCT
CAGCACGTTCCATGCTTACTATGAGAGCTATAACTGAGAAAGCAGGAGGAAGCTAGGTCTCCCGCCATCTGGGTGCTTGT
CCGAAAGAGATGCTGTAAGTGGTTACCTGTCAATCAAGAAATGCAAGACAATTCATATAGAGAATCTGCTATGATTAGCT
TCTTACTGGTGTCTCCTCTTCTTCCAGGTAACCCCAGACACCTGCATGTTCTCATTGGGACCTCAGTGGTCATCATCCTC
TTCATCCTCCTCCTCTTCTTTCTCCTTCATCTCTGGTACTCCAACAAAAAAAGTAAGTCTCACGCGGCACAGGCCAGAGA
GCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCACACAGCTGTGTGTTCCTCACTGGCAGGATGGTCCCTGGCCCAAGGC
AGCAGCCACAGAGGCAGGACTTTCTAGAGAGAGCACCAGACTCCCTGCCCCTGCCTTCAGCTCACAGACCGTTGCCTGAT
TCTGAACTGTATCCTCATGTCCCCCGCAGCCACTCACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGAGATAGA
ATCAATGGGATGGGAACTCAGAGCTATTCATGGGATGGGTCCTTGAGCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTG
GCAACTGAGGGACCTCAGGCACCTATGGCCTCCCCCTGTTTGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCC
TCCGAGCTCTTTTGTTGACTTCCGTCTCCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGCCAA
CAGCGAGGTAGGTGCTCCTCGGCCCAGCCTCGTGGCTAGTGTTATTCCCAAACAGTCCTGGAAAACGTGAGCACCCTCCC
TCACTCAGCATTTCCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGACTCTGATGAACAAGACCCTCAGGAGGTGACATA
CGCACAGTTGGATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGACACCCCCTACAGATA
CCATCTTGTACACGGAACTTCCAAATGCTAAGCCCAGATCCAAAGTTGTCTCCTGCCCATGAGCACCACAGTCAGGCCTT
GAGGGCGTCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGAGTTGCCAGCTCCCATGTACCAGCAGCTGGAATCTGAA
GGCCTGAGTCTTCATCTTAGGGCATCGCTCCTCCTCACGCCACAAATCTGGCCTCTCTCTTGCTTACAAATGTCTAGGTC
CCCACTGCCTGCTGGAAAGAAAACACACTCCTTTGCTTAGCCCACAGTTCTCCATTTCACTTGACCCCTGCCCACCTCTC
CAACCTAACTGGCTTACTTCCTAGTCTACTTGAGGCTGCGATCACACTGAGGAACTCACAATTCCAAACATACAAGAGGC
TCCCTCTTGACGTGGCACTTACCCACGTGCTGTTCCACCTTCCCTCATGCTGTTTCACCTTTCTTCGGACTATTTTCCAG
CCTTCTGTCAGCAGTGAAACTTATAAAATTTTTTGTGATTTCAATGTAGCTGTCTCCTCTTCAAATAAACATGTCTGCCC
TCAT

IPD-KIR