Allele Report for 3DL1*062


3DL1*062
Previous Designations & Local Names: FH05_A
IPD Acc No: KIR00454
Assigned: 28-AUG-2009 Sequence Last Modified: 16-AUG-2010
Source Entries: GQ890696 , GU182338  
Cells Sequence Derived From: BAR-005 , FH05  
Known Ethnic Origin Of Source: Black, Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
Protein Sequence (444 aa)
MLLMVVSMACVGFFLVQRAGPHVGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPIFHGRLFQESF
NMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGI
SKDPSSLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESV
TLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPS
SSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPQEVTYAQ
LDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP
Nucleotide Sequence Data (1335 bps)
ATGTTGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGGTCCAGAGGGCCGGTCCACACGTGGGTGGTCAGGA
CAAGCCCTTCCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACACGTGACTCTTCGGTGTCACTATCGTCATA
GGTTTAACAATTTCATGCTATACAAAGAAGACAGAATCCACGTTCCCATCTTCCATGGCAGATTATTCCAGGAGAGCTTC
AACATGAGCCCTGTGACCACAGCACATGCAGGGAACTACACATGTCGGGGTTCACACCCACACTCCCCCACTGGGTGGTC
GGCACCCAGCAACCCCGTGGTGATCATGGTCACAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGG
TGAAATCAGGAGAGAGAGTCATCCTGCAATGTTGGTCAGATATCATGTTTGAGCACTTCTTTCTGCACAAAGAGGGGATC
TCTAAGGACCCCTCAAGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAATTTCTCCATCGGTCCCATGATGCT
TGCCCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACACCCCCTATCAGTTGTCAGCTCCCAGTGATCCCCTGG
ACATCGTGGTCACAGGTCCATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCAAGGTTCAGGCAGGAGAGAGCGTG
ACCTTGTCCTGTAGCTCCCGGAGCTCCTATGACATGTACCATCTATCCAGGGAGGGGGGAGCCCATGAACGTAGGCTCCC
TGCAGTGCGCAAGGTCAACAGAACATTCCAGGCAGATTTCCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TCGGCTCTTTCCGTCACTCTCCCTACGAGTGGTCAGACCCGAGTGACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCA
AGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTAACCCCAGACACCTGCACATTCTGATTGGGACCTCAGT
GGTCATCATCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTCATCTCTGGTGCTCCAACAAAAAAAATGCTGCTGTAATGG
ACCAAGAGCCTGCAGGGAACAGAACAGCCAACAGCGAGGACTCTGATGAACAAGACCCTCAGGAGGTGACATACGCACAG
TTGGATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGACACCCCCTACAGATACCATCTT
GTACACGGAACTTCCAAATGCTAAGCCCAGATCCAAAGTTGTCTCCTGCCCATGA
Genomic Sequence Data (14549 bps)
GTTCGGGAGGTTGGATCTAAGACGTGTTTTGAGTTGGTCATAGTGAAGGACGCGAGGTGTCAATTCTAGTGAGAGCAATT
TCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCCT
CCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCG
CGGCCGCCTGTCTGCACCGGCAGCACCATGTTGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAAT
CGAGGGAGGGAGTGCGGGGATGGAGATCTGGACCTGGAGGTAAAGATATGGGCCTAGAGGTGGAGTTATGGGCCTGGAGG
TGGAGTTATGGGCCTGAAGTGGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATAGGGGCCTGGGGTGGA
GATATGTGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATATGTGCCTGGGGTGGAGATA
TGGGCCTGGAGGGGAGATATGGATGGGCCTGGAGGGGAGATGTGGGCCTAGAGGTGGAGTGATGGGCCTAGAAGTGGAGC
GATGGGCCTGGAGTGGAGATATGGGCCTGGAGGTGGAGTTATGGGCCTGCAGTAGAGATATGGGCCTGAAGTGGAGATAT
GGGCCTGGAGTGGAGATATGGGCCTAGAGGTGGAGTTATGGGCCCGGAGGTGGAGTTAAGGGCATGAAGTGGAGATCTGG
GCCTGGAGTGGAGATATGATCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATACGGGCCTGGAGCAGACATACAAGCCT
GGAAAGGAGATATGGGCCTGGAGAGGAGATAGAAGCCTGGAGTGGAAATATGGGCCTGGAGTGGAGATATGAGCCTGGAG
TGGATATATGAGCCTGGAGTTGAGATAGGAGCCTGGAGTGGAGATATGGGCCTGGAGTGGACTTATCAGCCTGGAGAGGA
GATATGGGTCTGGAGTGGAGATACGGACCTGGAGTGGAGATCTGGGCCTGTTGTGTAGATCTAGGCCTGGAGGTAGAGAT
CTGGGCCTGGAGGCTGAGTCTCTGCACAGCCGAGATCCTTGTTCCTGGGGGCAGGTAGGCAGCGAGGGTGAGTTTACCTT
CAGCCCAGCAAGGGCCTGGCTGCCAAGACGCACAGCCCAGTGGGGGCAGCAGGGTGCCCTGGTTTGCCTGCAGATGGATG
GTCCATCATGATCTTTCTTTCTAGGGTTCTTCTTGGTCCAGAGGGCCGGTCCACACGTGGGTGAGTCCTTCCCCAAACCT
TAGGGTGTCATCTCCCCACATAAGAGGATTTTCCTGAAATGGGAGGGAAGTCCTGTCGGGGAGTCTCTCATAAACTAGGA
AGAGGGGACCCTCGGATGCTCGGCCCACATTTCTGACCTTGCCCTCCCCGGCCTTTCTTTCCCTTTCCTGAGTCAAGCTC
TGTGAAGACTGGGGTGAGACTAGGGTGCTCCAAGACGGGTGTGCAGGGAGGAAGTGGTGTCAGCAGCAGAGAAAGAGAGG
GAAGCAGTGCTAGGAACAGCAGGTCCTCTGAGGACAAAGGTGTAACTCACACCCTCCAGCGTTTCCGTGATGGTAGGGGC
TGCAGTGTGGCTGTGGTCTTTCTACCAGAAAAGGTGAGGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGATGG
GGGCTCAGTTCATCAATTGGCTGATATTCCATTCACATAGGACTTGCCCTCCATGCCGTGTCTACTTTGTGTTGTTTTAT
ATGAGTAATTTTGCAGTATTAAAATCTAGTAAGAGTTGCTTCTCCAGCACTTGCTCAAAGTTCTCAGCTGACACTTGTTG
TAGGGAGACGCCATGTCTATGCAGGATGGGTCCTTCCTGTAGCCCTGGGCACCCAGGTGTGGTAGGAGCCTTAGAAAGTG
GAAATGGGGAGAATCTTCTGGGCACTGGGAGTGAGGGGCGGCTCCACATCCTCCTCTCTAAGGCAGTGCCTCCTTCTCCC
CCAGGTGGTCAGGACAAGCCCTTCCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACACGTGACTCTTCGGTG
TCACTATCGTCATAGGTTTAACAATTTCATGCTATACAAAGAAGACAGAATCCACGTTCCCATCTTCCATGGCAGATTAT
TCCAGGAGAGCTTCAACATGAGCCCTGTGACCACAGCACATGCAGGGAACTACACATGTCGGGGTTCACACCCACACTCC
CCCACTGGGTGGTCGGCACCCAGCAACCCCGTGGTGATCATGGTCACAGGTCAGAGGCTTTCCGTCTGGGCTTCTCACTG
TCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGGGTGTCCGTCAGGGTCCCATCACCCAGGCCCTGACTGTATTTGGGGT
CAAGGGAGATTGAATACAGGGGAAATGGGTGCTGTGGTGGGAAGAATCACTGTCCCCAATGATGGCTACATTGTAATCCC
TGGAGCCTGTGACTATTTATGTTACAGGGCAGGGGACTGAAGGGGAAGGTGGAGCTCAGGTTGTTGATGAGTTGACCTTG
AGATGGGGAGACAGCCTGGACTGTCCCACTGGGCTCAGTGTAATCACAAGGGTCCACATGAGAGGTGGAGGAAGAGGGGA
GTGGGGATTAGAGCAGTGTAGTGGGAGGGAGACGCTATCAGCCACTGCGGGCTTTGAAGGTGGAGGAAGACCACTAGTCA
CAGAATGCAGGTGGCCTCTAAGGGCTGGAGAAGTCAAGAGAACTGATTCGCTGATTCTCCAGAGGGAACGCAGCCCTGTA
GACACCTTGATTTCAGCACAGGGAGAACTGGATCCAATTTCTGTCTCCAGAAGTGGAAGGGGTCAGTGTGTTCTCTCCCG
CTGCCATGTTTGTGGTAATTTTCTGCAGCAGCAACAGGAAACCAACACAGGAACCCAGGTCAAGGACAAGTTAGGAAACC
AAACAAGGATAGCCAGATGTGGTGGTGGGCGCGAGTAATCCAACGACTGGGGAGGCTGAGGCAAGAGAATCACTTGAACT
GGGGATTTGTTCAAAAGAGATTGATTCAGGCTGCTAAGAGCCTGGACATGCAGCCTGTCCTCTTCCACCCCCACATAGAC
AGCAGGAAAGAGATTAGTGGGAAACAGATACAACAGCCCAAGAGATGAGGCTGTCTTCACAGTGGCAAGGGAGTCAGGGG
CTACTGGAGACAGAGGGACAGAGAAGAGGGAGGAAGACAGATGGAGGCACCTGCACCAGGGGATATGGGCACAGAAAAGA
CACGGAGATGCAGAGAGGGAGGAGAGAGACAGACACGGGGAGGGGAACCCTCACTCATTCCAGGTGCCATGGATGGGATG
ATAAAGAGAGATGCCTTCTAAACTCACAACTTCTCTTTCTAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGT
CCCCTGGTGAAATCAGGAGAGAGAGTCATCCTGCAATGTTGGTCAGATATCATGTTTGAGCACTTCTTTCTGCACAAAGA
GGGGATCTCTAAGGACCCCTCAAGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAATTTCTCCATCGGTCCCA
TGATGCTTGCCCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACACCCCCTATCAGTTGTCAGCTCCCAGTGAT
CCCCTGGACATCGTGGTCACAGGTGAGAGTGTCTAGACATTGTTCTCATTGTCACTGGGACACAGAGTGAATGATCCAGG
ACTTGGAACCCCCAGGTGGTCATGAGGAAGATAAGTGTGGGATTCTTATGGAAAGAGAGTGACTTGGTGAGGTCTGTACC
AACAGAGACAGAGAAACAGGAGACATAAGTACAGAACAGGTGTCATAACAGAGGACAGACACAGGGGCCATACAGGGAGG
TAGAAAAGAGAGAAAGAGGTAAAGGAGACACTCAGACAGACAGACATGTCCCAGAGAGAGGTGTCCTTCCATGCTGACTT
TGCTCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTGTTCCTACCAGAAGAACCCAAGGA
CACCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGCCACCTACAGATGCCGTGTTTATTCTGACACC
TCTGCCTTCCATGCAATGGAGAGTAATCATCCCAGGATATCATGGCCCCTGAACACCAACCCCTGTATGCTGTGTGAACT
TGGGGTCCCCAGACTGGATTCTGAGGCTCATATTCCAAATAATCCCACATATGATAGGATCGCTGAGAGACACAGAGAAA
AATCAGGGACACCAAAAAACAAAGACATAAACACACACAAAATGAGCCAGAAGAAGGAGATTAAGAGATTCACAGACACA
TAAAAAGAAAGAAAAGAGGGCAGAATGGAGAGAATGATGGAAAGGAGGAGAGAAAAGCCCCAAAATCAGAACCCTGAGGG
AGGGACACAAAGACAGAGAAAGATAAATATGTGGGGATGGATTGCAGAGATTCCAAATAGAACTAGAGAGACTGAGAGGC
AGAGAAAGACAAGGAGACGGAGAGAGAGAGATGATAGATGGATAGATAGACGTAGATAGATGATAAATAGGTAGATGATA
GATAATGGATTGGTTATAGATACATAGATGATGACTGATAGATGATACATAGAGATGACGATGATGATGATAGACACATA
GATATATACATAGATGATACATAAATAGAGACAGAGAGGCAGACAGAGAGGTAATAGAGAGAGAGATAGATGATACATAT
ATAGATAATAGATGATTGATGGATAGATAGACAGATAGACAATTGATAGAGAGATAGATAAGTGATACATAAATATAGAT
GATAGATAATTTGTAGATAGACACAAAATAGATAAATAGATAGAAATGTGCAGAAAGTTATGACCAAGACAGAAAGTGAG
AGACTCAAAATTAAAGAAAAAGGAAGATCAAGTCAACCAATCCAAGGAGGGTCAGAGAGAATAAAACAATCCAAAAAGGG
AAAACATACCTCAGGGTGGGGAAGTGAGGTCATAGACCTAGAGAGACAGAAAAGGTAGAAGGAGGAAACAGATATGAAGA
GAGATGGGGTGGAGGGTGAGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTATGAG
GGGAGCTATGACAAGGAAGAACCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCCATATGAGAAACCTTCTCTCTCA
GCCCAGCCGGGCCCCAAGGTTCAGGCAGGAGAGAGCGTGACCTTGTCCTGTAGCTCCCGGAGCTCCTATGACATGTACCA
TCTATCCAGGGAGGGGGGAGCCCATGAACGTAGGCTCCCTGCAGTGCGCAAGGTCAACAGAACATTCCAGGCAGATTTCC
CTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTCACTCTCCCTACGAGTGGTCAGACCCG
AGTGACCCACTGCTTGTTTCTGTCACAGGTGAGAAAAGCCCATATCTCTCTCATGTCCTATGATCCTAAATCCTTAGCTA
AGGAGCTTCCTGCTGATGATGGAGAAAAGCATGGACAGATGCAGAGAGAAGACACAGCAGGTGTGAGGGCGGAGTCAGGG
CGCAGGATGGCAGACAGGGCACCTCCAAACCCTCCTTCATGGCCTGCATGGAGGCCTCCGATCAGGGCTCCAGGCACCCA
GGCAGATGGAGAAAGCGGTCAGGACAGACCCAGAGAAGGGGAGACTGGGCTTAGTTTGGGGAGATCAGAGGTTCCCTCAG
CCCCTCAATCTTATCCATTTCCCAGAAGCCCATCATGGCCTCTCACCCACACAGAGAGATATCATCACCAGCAACCCCTA
CACCCTTTTCTTTTCATTTTCAAAAATATTTATTGAGGTTAAATGTAACTATATAATTTACCACCTTTACCATTTTTAAA
AGTAAAATCTAGTGGTCATAAATACCTTTATATGCTGGGTGTGGTGGTTCACGGTTGTAATCTCGGCGCTTTGAGAGGCC
AAGGAAGGTGGATCATTTAAGATCAGGAACTCGAGATCACCCTGGCCAACATGTGGGAAATTCATCTTTACTAAACAGAC
AAGAAAAATTAGCCGAGCATGCTGGCATGCACCTGTAGTCCTAGCTACTTGGGAGGCTGAGGCAGGAGAAGCACTTAAAC
CCAGGAGGCAGAGGTTGCACTGAGCCGAGATCATGCCACTGCACTGCAGCCTGGGAGACAGAGAGAGACTCTGTTTCTAA
ATAAATAAATACATCTATATTCTTTTTTTTGTTACCCTCCACCCTTCCCTTCCTGGCCTCTGGTGTCCACCATTGTATTC
TCCACCTTCATGAGATCCACCTTTTATCTCCTGCATGTGGGTGAGAAATGGGAATCTTTGTAATGACCTCCAGTTCCATC
CATGTGGCTGCAAATGACAGGATGTTATTGTTTCTATGGATGAGTAGTCTCCACTGTGTGTGTGTACCACAGTTCTCTAT
CCATTCACCCACTGATGGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGGAACAGTCATATGAGTGC
AGATATCACTTCAATACACTGATGTCCTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGACACTATGAAAGTTCT
CTTTTTTTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGTCCAAGCTGGAGTCTAAGTGGTGAGATCTTGGCTCAT
TGCAACCTGTGCCTCCTAGGTTCAAATGATTGTCCTGACTCAGCCTCCCTAGTAGCTGTGATTACAGGTGCACGCCACCA
TGCCTGGCTAATTTTTGTATTTTTTTAGCACAGACGGGATATCCCAATTTTGGGCAGGCTGCTCTCAAACTCCTGACCTC
AAGTGAGGTGCCTGCCTCGGTTTCCCAAAGTGCTGAAGTTACAGGCATAAGCCACTATGCCCAGCCTCCTTTTAGTTTTT
TAAAGAATTTCCATACTTTTCTCCATAATAGTTGTACTAATTTACATTCCTACCAACAGGGTACCAGGGTTCTCCTTTCT
CTACCATCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGTAAAAGCCATTTTACTTTACTTTATTTTATTTATTTATTTAT
GTTGAGATGGAGTTTCACTCATAGTCTCCCAGGCTGGAGTGCAAGGGTGTGATCTCAGCTCACTGCAACCTCCGCCTCCC
GCGTTCAACTGATTCTCCTGCCTCAGCCTCCAAAGTAGCTGGGATTACAGGCATGTGCCACCACGCCTAGCTAATTTTTG
TATGTTTAGTAGAGAGGGAGTTTCTCCATGATGGTCAGGCTGGTCTCCCGACCTCAGGTGATCCGCCCACCTCCGCCTCC
TGAAGTGCCGGAATTACAGGCGTGAGCCACCGGCCTAAAAGGCATTTTAATGGGATGAGATGAAAACTCATCGCGATTGT
AATTTACATTTCTCTGATGATGAGTGATGCCGAGTACTTTTTCATATACGTGATCGCCATTTCTATGTTTTGTTTGTGGA
GAAATGTCTCCTCATGTCTTTTGCTCGTTTTTTAATTAAATTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCCAGTT
ATTAATCCCGTCTCAGATGAATAGTTTGCAAATATTTGCTCCTATTTTGTCGGTTGTCTCTTCACTTTCTTGGTTTATCT
TTTGTGGTGCAGAAGTTGCTTGGTTTGATGTAATCCTAATGGTCTATTTTTTGCTTTGATTACTTGTGTTTTGAAGGTTT
TAAACAAAATGTCTTTCGTCAGACAAATGTCTTCCCCATTATTTTCTTCTACATGTTTCATAGGTTCAGGCCTTAGACTC
ATGTTTTTAATCCATTTTCATTTGATTTTTGTGTATGGTGACAGGTATAGATGCAGTTTTATTCCTCTGCATGTAGATAT
CCAGTTTTCCCCACACCATTTATTGAAAAGACTGTCCTTTCCTGATTGTAAGTTCTCGGCACCTTTGTCAAAGTCCATTA
AATGGGCTGGGTATGGTGGCTCACACCTGCAATTCCAGCACTTTGGGAGGCCGAGGCGGGTGGATCACCTGAAGCCAGGA
GTTCAAGATCAGGCTGGCCAACAGAGTGAAACCTCGTCTCTACTAAAAATACAAAAATTAGCTGAGCATGGTGACCAGTG
CCTGTAATACCACTACTCGGGTGTTTGAGGCAAGAGAATTGCTTGAATCCAGGAAGTGGAGGTTGCATTGAGCTGAGATT
GCACCTCTGCACTCCAGCCTGCATGACAGAGCAAGATTCTAACACACACACACACAAAAAAAGCCATTGGATGTAAATGC
ATGGATTATATCTGTGTTCTCCATTCTGTTTCATTTTTTATGTGCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTAC
TACAGCTCTGTAACATATTTCTAAGTCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTCAAGTCTCAAGACAGTG
GGCATCGCACACAAAAATTATGGAGAAGAGGATCCCAAGACTCCCAGGGTCCAACATTAGATAACAGAGTGTTGGCCATG
AACCAACCTCAAAGATTTCCATTGAGTAGAGGACAAGCACCCTCATTTCCTCACATCTCTCCTGTCCCATGTTCTAGGAA
ACCCTTCAAGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTGAGTAAAGGACCCCTCTTATCTCTGCTTTT
GGAAACCTGGGGAGGTGGAAGCCTTGGATGCAAGTGTTGGCTCAAACCTCCCAGCTCTGTGAATGAGGGCCTGTCTTCCA
CCATCTCTGAACTCCAGACACTCCAACAGTGAAAGGGATCTAGGGCCACCAAAGGGCTCAGCGAAGTCTCTTAACCTTTA
ATGTCCTGCAGGTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAACATGCAGTGTTT
TTTCTTCCTGCATTCCTAACTGGAGGATAAATTCCTGGGGACTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGCG
AGGTGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAATTACTGTTGGTCATGAAGCAACCCTGGCTGACTCAGCAGAGCA
AGAGCCTTGCCGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTC
AGGCTGTGCAGTTGGAATCCTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTTT
TTAATTATCTTACAGTGCTGTAGCTCAAAGTAGGAAGTGCATCTTACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCT
TCCCTCTGAGGATTCCAGGCAAGAATCTGCTTCTCACTTGTCCCAGCTTCTAAAGGCTCCCAGTTCCTTGGCTCCTGGTC
CCCTTCCTCCTTCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACC
TCTTTCTCTGAATGCTGCTCTCCCTTCTTCCTTATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAAT
CCATCATAATCTCCCGGAAATCATTCAGGATACCCTTGTTTTAAGTTCAGCTGACTAGCAACCGTAATTCCATCTGCAAT
CTTCATTCCTTCTTTCCATGTAAAATAAGATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGC
ATTCTCCTGCCTTCCACGAACGGTGAACAAGATGCATTTGGCCTCTGCTCTTGGGACACTGATATTGCAGATGGTTAAAT
GGGAGGACAGAAAATGAATGCACAAGTGGACCAATAAATGAATGATCCATTGGGAAGCATCTGTGCATGAAATCTATTTG
TTTGTTCGTTCATTTATTTATTGAGACAGAGTCTCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCAC
TGCAACCTGCGTCTCCTGGATCCAAGTGATTCTCCTGCCTCACCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCA
TGCCCGGCTAATTCTTTTTGTATATTTTTTGTAGAGAGGATGTTTCACCATGTTGGCCAAGCTTGTCTGAAACTCCCAAC
CTCAAGTGATCCGACCATCTCAGCAACCCAAAGTACTGGGATTACAGGCGTGAGCCACTTTGCCCAGCCAGAATTCAAAA
TAAATAATAGATAATGCTGAGTGTATAATTTTGGGTGACAGAGAAGGTCTCACTAATCAGATATTTGTGACATTAATGAA
AAACACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTTTCCACACACAGCTGTCAGCCGTGAAGGCAGAAAGCTGAAA
ACAATCTGATGTGGAAGGAAGAGGCTCTGCCTGAAATGCTGGGAATGAGGTGGGGAGAATGACAAGACGACTGTGGAGAG
ACGGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACC
TCGGGGTAGCCAGGAATCCCTACATGATTAATAGTGACTGACATGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCT
AGGAGACAGTGGAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACCCTAAGTGGATGAAGCAGATG
GATATAAGCTATGTTTGGGAGGTAGAATCATTTGCAGGGAGGGCTTGCTGGGTTTGAGTTTCCTAGTTGTTTAATCCTTG
CTAAATTAATTTCTTTCTGAGATTTATTCCTCCTACACATAAATCAATACCTGCCAAAGGAGTGACAGATATATGAGGGG
TGGTGGAAATGAAGGGACCTATTATAGCATAGTATACAAGTCTGTGAACGGTGGCTCACTCCTGTAACCCAGCACTGCAG
GAGGCTAAGGCCAGTGGATTCCAAGAAGTCAGGAGTTCGAGACCAGCCTGGCCAACATGGAGAAACCCTATCTCTACATG
GTGAAACCCTATCTCTCCTAAAAATACAAAAATTAGCCGAGCATGGTGGTGCATCCCTGTAATCCCAGCTCCTGCTCTGG
AGGATGAAGCAGGAGAATGACTTCAACCCAGGAGGTGGAGGTTGCAGTGAGTGGAGATCGCATCACTGCACTCCAGCCTG
GGTGACACAAGGAGACTCCATCTCAAAAAATAAAAATAAGAAATGCATAAATATAATAAAACACACACGAATGACAAAGG
CACCTGAATTCCCATCATCATTTTTCTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATCAGC
CTAAAACCTCTTCCGTATTTGGCTTTCTGTGAGCATGAGATCATATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCAC
AAATCCTGGAATAGAGAAAGTGCTCTGGTCATCACAAAAAAAACTTGCCCCCTCACCCAAATCCCCCATCTCACCCCTAC
TTCCAATCACCTGTGGAGATACAGATAGATCATGGGGAGGTAAATGCTAATACTCCTTGGAGTGAGTCCAGATCTTGGAA
TCAGAGATCAGTGCCAGCACTAGCTCCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTATTGAAGCAATAGA
TAGTCGAGGGGGTGGTCCTTCCCCCAGCCTCTGAGGTAGAACAGCAGCCTAACATGTGTCTCCCGAGATCACAAAGAGTA
GCACATTTCACACGGGCTTCAACACTATTTTCTGGCTGTTTGACATAAGAGAATTCTACTTCGCTTTTTTTATATTGATT
TCACTTTTGTTTCCTTTTCTTGGAGAATGCAAGTTGTTTAACTCAAGAATGCCGTGGATGTAGAAATCCTAAAGCACATT
CGCTGTGTATCAATCCCAGTCCAGTCTTCCCAGAGAAGACTCTAAACACCTCCTGGACTGCACCTGGGCCTATGCCAATT
CCTATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAG
CAGCGAGTGACAACAGAAGCCTACATTTCAATGTGAGCCAGTTCCCCAAGGCTCAGAAAAGCTGCTCGAGACATGTGGAG
TCACCCCATTTGCAGTGTAGCTGGGGGAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCAC
TCAGCTAAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGGGACGATCCTCCTGAT
CTCAGGACTTTGCTGTCTTAGTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGGGTAACTTCTAAAGAAGAGATTG
GTTTGCCTCACCATTCTGCAGGCTGTACTGGAAGCATGGCACCAGCATCTATTTCTTATGATGGCCTCAGGCCGCTCCCA
CTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCACAGAGATCACACGGCAAGAGAGGGAGCAAGGGGGAGGGG
GAGCAATGGAGCTTCCAAGCTCTTTTTAACAACCAGCTCTCCAGGAACTAATAGAGAGGGAACTTGCTAACCCCGTCTCC
TTGGGACAGCATTGATCTGTTCATGATGGATCCACCTCCATGACCCAAACACCTCCCAAGAGGCCCAACCTCCCACACTG
GGGGTTAAATTTCAATGTGAGGTTTGAAGGGGTCAAACATCTCAACTAAAGTAGTTGTATCCTCAGCACGTTCCATGGTT
ACTATGAGAGCTATAACTGAGAAAGCAGGAGGAAGCTAGATCTCCCGCCATCTGGGTGCTTGTCCGAAAGAGATGCTGTA
AGTGGTTACCTGTCAATCAAGAAATGCAAGACAATTCATATAGAGAAACTGCTATGATTAGCTTCTTACTGGTGTCTCCT
CTTCTTCCAGGTAACCCCAGACACCTGCACATTCTGATTGGGACCTCAGTGGTCATCATCCTCTTCATCCTCCTCCTCTT
CTTTCTCCTTCATCTCTGGTGCTCCAACAAAAAAAGTAAGTCTCACGGGGCACAGGCCAGAGAGCTCAGGGCCATGTGGG
GAAGCAGGATGGGAGCACACAGCTGTGTGTTCCTCACTGGCAGGATGGTCCCTGGCCCAAGACAGGAGCCACAGAGGCAG
GACTTTCTAGAGAGAGCACCAGACTCCCTGCCCCTGCCTTCAGCTCACAGACCGTTGCCTGATTCTGAACTGTATCCTCA
TGTCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGAGAGGCAGAAAGTGGGAGACAGAATCAATGGGATGGGAAC
TCAGAGCTATTCATGGGATGGGTCCTTGAGCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCA
GGCACCTATGGCCTCCCCCTGTTTGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTCTTTTGTTG
ACTTCCGTCTCCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGCCAACAGCGAGGTAGGTGCTC
CTCGGCCCAGCCTCGTGGCTAGTGTTATTCCCAAACAGTCCTGGAAAACGTGAGCACCCTCCCTCACTCAGCATTTCCCT
CCCTCACTCAGCATTTCCCTCTCTCCAGGACTCTGATGAACAAGACCCTCAGGAGGTGACATACGCACAGTTGGATCACT
GCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGACACCCCCTACAGATACCATCTTGTACACGGAA
CTTCCAAATGCTAAGCCCAGATCCAAAGTTGTCTCCTGCCCATGAGCACCACAGTCAGGCCTTGAGGACGTCTTCTAGGG
AGACAACAGCCCTGTCTCAAAACCGAGTTGCCAGCTCCCATGTACCAGCAGCTGGAATCTGAAGGCGTGAGTCTTCATCT
TAGGGCATCGCTCCTCCTCACGCCACAAATCTGGTGCCTCTCTCTTGCTTACAAATGTCTAGGTCCCCACTGCCTGCTGG
AAAGAAAACACACTCCTTTGCTTAGCCCACAGTTCTCCATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTT
ACTTCCTAGTCTACTTGAGGCTGCAATCACACTGAGGAACTCACAATTCCAAACATACAAGAGGCTCCCTCTTGACGTGG
CACTTACCCACGTGCTGTTCCACCTTCCCTCATGCTGTTTCACCTTTCTTCGGACTATTTTCCAGCCTTCTGTCAGCAGT
GAAACTTATAAAATTTTTTGTGATTTCAATGTAGCTGTCTCCTCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR