Allele Report for 3DL1*025


3DL1*025
Previous Designations & Local Names: 3DL1_mc4
IPD Acc No: KIR00149
Assigned: 30-JAN-2006 Sequence Last Modified: 18-JAN-2008
Source Entries: AY760039 , GQ421738 , GU182360  
Cells Sequence Derived From: ABC08 , GM17187 , MC4  
Known Ethnic Origin Of Source: Black, Caucasoid
Publications
Norman PJ et al. Nature Genetics 39:1092-9 2007. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
Protein Sequence (444 aa)
MLLMVVSMACVGFFLVQRAGPHVGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPIFHGRLFQESF
NMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGI
SKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESV
TLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPS
SSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPQEVTYAQ
LDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP
Nucleotide Sequence Data (1335 bps)
ATGTTGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGGTCCAGAGGGCCGGTCCACACGTGGGTGGTCAGGA
CAAGCCCTTCCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACACGTGACTCTTCGGTGTCACTATCGTCATA
GGTTTAACAATTTCATGCTATACAAAGAAGACAGAATCCACGTTCCCATCTTCCATGGCAGATTATTCCAGGAGAGCTTC
AACATGAGCCCTGTGACCACAGCACATGCAGGGAACTACACATGTCGGGGTTCACACCCACACTCCCCCACTGGGTGGTC
GGCACCCAGCAACCCCGTGGTGATCATGGTCACAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGG
TGAAATCAGGAGAGAGAGTCATCCTGCAATGTTGGTCAGATATCATGTTTGAGCACTTCTTTCTGCACAAAGAGGGGATC
TCTAAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAATTTCTCCATCGGTCCCATGATGCT
TGCCCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACACCCCCTATCAGTTGTCAGCTCCCAGTGATCCCCTGG
ACATCGTGGTCACAGGTCCATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCAAGGTTCAGGCAGGAGAGAGCGTG
ACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTATCCAGGGAGGGGGGAGCCCATGAACGTAGGCTCCC
TGCAGTGCGCAAGGTCAACAGAACATTCCAGGCAGATTTCCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TCGGCTCTTTCCGTCACTCTCCCTACGAGTGGTCAGACCCGAGTGACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCA
AGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTAACCCCAGACACCTGCACATTCTGATTGGGACCTCAGT
GGTCATCATCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTCATCTCTGGTGCTCCAACAAAAAAAATGCTGCTGTAATGG
ACCAAGAGCCTGCAGGGAACAGAACAGCCAACAGCGAGGACTCTGATGAACAAGACCCTCAGGAGGTGACATACGCACAG
TTGGATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGACACCCCCTACAGATACCATCTT
GTACACGGAACTTCCAAATGCTAAGCCCAGATCCAAAGTTGTCTCCTGCCCATGA
Genomic Sequence Data (14549 bps)
GTTCGGGAGGTTGGATCTAAGACGTGTTTTGAGTTGGTCATAGTGAAGGACGCGAGGTGTCAATTCTAGTGAGAGCAATT
TCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCACGCAAGGTAGAAAGAGCCTGCGTACGTCACCCT
CCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCG
CGGCCGCCTGTCTGCACCGGCAGCACCATGTTGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAAT
CGAGGGAGGGAGTGCGGGGATGGAGATCTGGACCTGGAGGTAAAGATATGGGCCTAGAGGTGGAGTTATGGGCCTGGAGG
TGGAGTTATGGGCCTGAAGTGGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATAGGGGCCTGGGGTGGA
GATATGTGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATATGTGCCTGGGGTGGAGATA
TGGGCCTGGAGGGGAGATATGGATGGGCCTGGAGGGGAGATGTGGGCCTAGAGGTGGAGTGATGGGCCTAGAAGTGGAGC
GATGGGCCTGGAGTGGAGATATGGGCCTGGAGGTGGAGTTATGGGCCTGCAGTAGAGATATGGGCCTGAAGTGGAGATAT
GGGCCTGGAGTGGAGATATGGGCCTAGAGGTGGAGTTATGGGCCCGGAGGTGGAGTTAAGGGCATGAAGTGGAGATCTGG
GCCTGGAGTGGAGATATGATCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATACGGGCCTGGAGCAGACATACAAGCCT
GGAAAGGAGATATGGGCCTGGAGAGGAGATAGAAGCCTGGAGTGGAAATATGGGCCTGGAGTGGAGATATGAGCCTGGAG
TGGATATATGAGCCTGGAGTTGAGATAGGAGCCTGGAGTGGAGATATGGGCCTGGAGTGGACTTATCAGCCTGGAGAGGA
GATATGGGTCTGGAGTGGAGATACGGACCTGGAGTGGAGATCTGGGCCTGTTGTGTAGATCTAGGCCTGGAGGTAGAGAT
CTGGGCCTGGAGGCTGAGTCTCTGCACAGCCGAGATCCTTGTTCCTGGGGGCAGGTAGGCAGCGAGGGTGAGTTTACCTT
CAGCCCAGCAAGGGCCTGGCTGCCAAGACGCACAGCCCAGTGGGGGCAGCAGGGTGCCCTGGTTTGCCTGCAGATGGATG
GTCCATCATGATCTTTCTTTCTAGGGTTCTTCTTGGTCCAGAGGGCCGGTCCACACGTGGGTGAGTCCTTCCCCAAACCT
TAGGGTGTCATCTCCCCACATAAGAGGATTTTCCTGAAATGGGAGGGAAGTCCTGTCGGGGAGTCTCTCATAAACTAGGA
AGAGGGGACCCTCGGATGCTCGGCCCACATTTCTGACCTTGCCCTCCCCGGCCTTTCTTTCCCTTTCCTGAGTCAAGCTC
TGTGAAGACTGGGGTGAGACTAGGGTGCTCCAAGATGGGTGTGCAGGGAGGAAGTGGTGTCAGCAGCAGAGAAAGAGAGG
GAAGCAGTGCTAGGAACAGCAGGTCCTCTGAGGACAAAGGTGTAACTCACACCCTCCAGCGTTTCCGTGATGGTAGGGGC
TGCAGTGTGGCTGTGGTCTTTCTACCAGAAAAGGTGAGGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGATGG
GGGCTCAGTTCATCAATTGGCTGATATTCCATTCACATAGGACTTGCCCTCCATGCCGTGTCTACTTTGTGTTGTTTTAT
ATGAGTAATTTTGCAGTATTAAAATCTAGTAAGAGTTGCTTCTCCAGCACTTGCTCAAAGTTCTCAGCTGACACTTGTTG
TAGGGAGACGCCATGTCTATGCAGGATGGGTCCTTCCTGTAGCCCTGGGCACCCAGGTGTGGTAGGAGCCTTAGAAAGTG
GAAATGGGGAGAATCTTCTGGGCACTGGGAGTGAGGGGCGGCTCCACATCCTCCTCTCTAAGGCAGTGCCTCCTTCTCCC
CCAGGTGGTCAGGACAAGCCCTTCCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACACGTGACTCTTCGGTG
TCACTATCGTCATAGGTTTAACAATTTCATGCTATACAAAGAAGACAGAATCCACGTTCCCATCTTCCATGGCAGATTAT
TCCAGGAGAGCTTCAACATGAGCCCTGTGACCACAGCACATGCAGGGAACTACACATGTCGGGGTTCACACCCACACTCC
CCCACTGGGTGGTCGGCACCCAGCAACCCCGTGGTGATCATGGTCACAGGTCAGAGGCTTTCCGTCTGGGCTTCTCACTG
TCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGGGTGTCCGTCAGGGTCCCATCACCCAGGCCCTGACTGTATTTGGGGT
CAAGGGAGATTGAATACAGGGGAAATGGGTGCTGTGGTGGGAAGAATCACTGTCCCCAATGATGGCTACATTGTAATCCC
TGGAGCCTGTGACTATTTATGTTACAGGGCAGGGGACTGAAGGGGAAGGTGGAGCTCAGGTTGTTGATGAGTTGACCTTG
AGATGGGGAGACAGCCTGGACTGTCCCACTGGGCTCAGTGTAATCACAAGGGTCCACATGAGAGGTGGAGGAAGAGGGGA
GTGGGGATTAGAGCAGTGTAGTGGGAAGGAGACGCTATCAGCCACTGCGGGCTTTGAAGGTGGAGGAAGACCACTAGTCA
CAGAATGCAGGTGGCCTCTAAGGGCTGGAGAAGTCAAGAGAACTGATTCGCTGATTCTCCAGAGGGAACGCAGCCCTGTA
GACACCTTGATTTCAGCACAGGGAGAACTGGATCCAATTTCTGTCTCCAGAAGTGGAAGGGGTCAGTGTGTTCTCTCCCG
CTGCCATGTTTGTGGTAATTTTCTGCAGCAGCAACAGGAAACCAACACAGGAACCCAGGTCAAGGACAAGTTAGGAAACC
AAACAAGGATAGCCAGATGTGGTGGTGGGCGCGAGTAATCCAACGACTGGGGAGGCTGAGGCAAGAGAATCACTTGAACT
GGGGATTTGTTCAAAAGAGATTGATTCAGGCTGCTAAGAGCCTGGACATGCAGCCTCTCCTCTTCCACCCCCACATAGAC
AGCAGGAAAGAGATTAGTGGGAAACAGATACAACAGCCCAAGAGATGAGGCTGTCTTCACAGTGGCAAGGGAGTCAGGGG
CTACTGGAGACAGAGGGACAGAGAAGAGGGAGGAAGACAGATGGAGGCACCTGCACCAGGGGATATGGGCACAGAAAAGA
CACGGAGATGCAGAGAGGGAGGAGAGAGACAGACACGGGGAGGGGAACCCTCACTCATTCCAGGTGCCATGGATGGGATG
ATAAAGAGAGATGCCTTCTAAACTCACAACTTCTCTTTCTAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGT
CCCCTGGTGAAATCAGGAGAGAGAGTCATCCTGCAATGTTGGTCAGATATCATGTTTGAGCACTTCTTTCTGCACAAAGA
GGGGATCTCTAAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAATTTCTCCATCGGTCCCA
TGATGCTTGCCCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACACCCCCTATCAGTTGTCAGCTCCCAGTGAT
CCCCTGGACATCGTGGTCACAGGTGAGAGTGTCTAGACATTGTTCTCATTGTCACTGGGACACAGAGTGAATGATCCAGG
ACTTGGAACCCCCAGGTGGTCATGAGGAAGATAAGTGTGGGATTCTTATGGAAAGAGAGTGACTTGGTGAGGTCTGTACC
AACAGAGACAGAGAAACAGGAGACATAAGTACAGAACAGGTGTCATAACAGAGGACAGACACAGGGGCCATACAGGGAGG
TAGAAAAGAGAGAAAGAGGTAAAGGAGACACTCAGACAGACAGACATGTCCCAGAGAGAGGTGTCCTTCCATGCTGACTT
TGCTCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTGTTCCTACCAGAAGAACCCAAGGA
CACCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGCCACCTACAGATGCCGTGTTTATTCTGACACC
TCTGCCTTCCATGCAATGGAGAGTAATCATCCCAGGATATCATGGCCCCTGAACACCAACCCCTGTATGCTGTGTGAACT
TGGGGTCCCCAGACTGGATTCTGAGGCTCATATTCCAAATAATCCCACATATGATAGGATCGCTGAGAGACACAGAGAAA
AATCAGGGACACCAAAAAACAAAGACATAAACACACACAAAATGAGCCAGAAGAAGGAGATTAAGAGATTCACAGACACA
TAAAAAGAAAGAAAAGAGGGCAGAATGGAGAGAATGATGGAAAGGAGGAGAGAAAAGCCCCAAAATCAGAACCCTGAGGG
AGGGACACAAAGACAGAGAAAGATAAATATGTGGGGATGGATTGCAGAGATTCCAAATAGAACTAGAGAGACTGAGAGGC
AGAGAAAGACAAGGAGACGGAGAGAGAGAGATGATAGATGGATAGATAGACGTAGATAGATGATAAATAGGTAGATGATA
GATAATGGATTGGTTATAGATACATAGATGATGACTGATAGATGATACATAGAGATGACGATGATGATGATAGACACATA
GATATATACATAGATGATACATAAATAGAGACAGAGAGGCAGACAGAGAGGTAATAGAGAGAGAGATAGATGATACATAT
ATAGATAATAGATGATTGATGGATAGATAGACAGATAGACAATTGATAGAGAGATAGATAAGTGATACATAAATATAGAT
GATAGATAATTTGTAGATAGACACAAAATAGATAAATAGATAGAAATGTGCAGAAAGTTATGAACAAGACAGAAAGTGAG
AGACTCAAAATTAAAGAAAAAGGAAGATCAAGTCAACCAATCCAAGGAGGGTCAGAGAGAATAAAACAATCCAAAAAGGG
AAAACATACCTCAGGGTGGGGAAGTGAGGTCATAGACCTAGAGAGACAGAAAAGGTAGAAGGAGGAAACAGATATGAAGA
GAGATGGGGTGGAGGGTGAGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTATGAG
GGGAGCTATGACAAGGAAGAACCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCCATATGAGAAACCTTCTCTCTCA
GCCCAGCCGGGCCCCAAGGTTCAGGCAGGAGAGAGCGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCA
TCTATCCAGGGAGGGGGGAGCCCATGAACGTAGGCTCCCTGCAGTGCGCAAGGTCAACAGAACATTCCAGGCAGATTTCC
CTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTCACTCTCCCTACGAGTGGTCAGACCCG
AGTGACCCACTGCTTGTTTCTGTCACAGGTGAGAAAAGCCCATATCTCTCTCATGTCCTATGATCCTAAATCCTTAGCTA
AGGAGCTTCCTGCTGATGATGGAGAAAAGCATGGACAGATGCAGAGAGAAGACACAGCAGGTGTGAGGGCGGAGTCAGGG
CGCAGGATGGCAGACAGGGCACCTCCAAACCCTCCTTCATGGCCTGCATGGAGGCCTCCGATCAGGGCTCCAGGCACCCA
GGCAGATGGAGAAAGCGGTCAGGACAGACCCAGAGAAGGGGAGACTGGGCTTAGTTTGGGGAGATCAGAGGTTCCCTCAG
CCCCTCAATCTTATCCATTTCCCAGAAGCCCATCATGGCCTCTCACCCACACAGAGAGATATCATCACCAGCAACCCCTA
CACCCTTTTCTTTTCATTTTCAAAAATATTTATTGAGGTTAAATGTAACTATATAATTTACCACCTTTACCATTTTTAAA
AGTAAAATCTAGTGGTCATAAATACCTTTATATGCTGGGTGTGGTGGTTCACGGTTGTAATCTCGGCGCTTTGAGAGGCC
AAGGAAGGTGGATCATTTAAGATCAGGAACTCGAGATCACCCTGGCCAACATGTGGGAAATTCATCTTTACTAAACAGAC
AAGAAAAATTAGCCGAGCATGCTGGCATGCACCTGTAGTCCTAGCTACTTGGGAGGCTGAGGCAGGAGAAGCACTTAAAG
CCAGGAGGCAGAGGTTGCACTGAGCCGAGATCATGCCACTGCACTGCAGCCTGGGAGACAGAGAGAGACTCTGTTTCTAA
ATAAATAAATACATCTATATTCTTTTTTTTGTTACCCTCCACCCTTCCCTTCCTGGCCTCTGGTGTCCACCATTGTATTC
TCCACCTTCATGAGATCCACCTTTTATCTCCTGCATGTGGGTGAGAAATGGGAATCTTTGTAATGACCTCCAGTTCCATC
CATGTGGCTGCAAATGACAGGATGTTATTGTTTCTATGGATGAGTAGTCTCCACTGTGTGTGTGTACCACAGTTCTCTAT
CCATTCACCCACTGATGGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGGAACAGTCATATGAGTGC
AGATATCACTTCGATACACTGATGTCCTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGACACTATGAAAGTTCT
CTTTTTTTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGTCCAAGCTGGAGTCTAAGTGGTGAGATCTTGGCTCAT
TGCAACCTGTGCCTCCTAGGTTCAAATGATTGTCCTGACTCAGCCTCCCTAGTAGCTGTGATTACAGGTGCACGCCACCA
TGCCTGGCTAATTTTTGTATTTTTTTAGCACAGACGGGATATCCCAATTTTGGGCAGGCTGCTCTCAAACTCCTGACCTC
AAGTGAGGTGCCTGCCTCGGTTTCCCAAAGTGCTGAAGTTACAGGCATAAGCCACTATGCCCAGCCTCCTTTTAGTTTTT
TAAAGAATTTCCATACTTTTCTCCATAATAGTTGTACTAATTTACATTCCTACCAACAGGGTACCAGGGTTCTCCTTTCT
CTACCATCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGTAAAAGCCATTTTACTTTACTTTATTTTATTTATTTATTTAT
GTTGAGATGGAGTTTCACTCATAGTCTCCCAGGCTGGAGTGCAAGGGTGTGATCTCAGCTCACTGCAACCTCCGCCTCCC
GCGTTCAACTGATTCTCCTGCCTCAGCCTCCAAAGTAGCTGGGATTACAGGCATGTGCCACCACGCCTAGCTAATTTTTG
TATGTTTAGTAGAGAGGGAGTTTCTCCATGATGGTCAGGCTGGTCTCCCGACCTCAGGTGATCCGCCCACCTCCGCCTCC
TGAAGTGCCGGAATTACAGGCGTGAGCCACCGGCCTAAAAGGCATTTTAATGGGATGAGATGAAAACTCATCGCGATTGT
AATTTACATTTCTCTGATGATGAGTGATGCCGAGTACTTTTTCATATACGTGATCGCCATTTCTATGTTTTGTTTGTGGA
GAAATGTCTCCTCATGTCTTTTGCTCGTTTTTTAATTAAATTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCCAGTT
ATTAATCCCGTCTCAGATGAATAGTTTGCAAATATTTGCTCCTATTTTGTCGGTTGTCTCTTCACTTTCTTGGTTTATCT
TTTGTGGTGCAGAAGTTGCTTGGTTTGATGTAATCCTAATGGTCTATTTTTTGCTTTGATTACTTGTGTTTTGAAGGTTT
TAAACAAAATGTCTTTCGTCAGACAAATGTCTTCCCCATTATTTTCTTCTACATGTTTCATAGGTTCAGGCCTTAGACTC
ATGTTTTTAATCCATTTTCATTTGATTTTTGTGTATGGTGACAGGTATAGATGCAGTTTTATTCCTCTGCATGTAGATAT
CCAGTTTTCCCCACACCATTTATTGAAAAGACTGTCCTTTCCTGATTGTAAGTTCTCGGCACCTTTGTCAAAGTCCATTA
AATGGGCTGGGTATGGTGGCTCACACCTGCAATTCCAGCACTTTGGGAGGCCGAGGCGGGTGGATCACCTGAAGCCAGGA
GTTCAAGATCAGGCTGGCCAACAGAGTGAAACCTCGTCTCTACTAAAAATACAAAAATTAGCTGAGCATGGTGACCAGTG
CCTGTAATACCACTACTCGGGTGTTTGAGGCAAGAGAATTGCTTGAATCCAGGAAGTGGAGGTTGCATTGAGCTGAGATT
GCACCTCTGCACTCCAGCCTGCATGACAGAGCAAGATTCTAACACACACACACACAAAAAAAGCCATTGGATGTAAATGC
ATGGATTATATCTGTGTTCTCCATTCTGTTTCATTTTTTATGTGCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTAC
TACAGCTCTGTAACATATTTCTAAGTCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTCAAGTCTCAAGACAGTG
GGCATCGCACACAAAAATTATGGAGAAGAGGATCCCAAGACTCCCAGGGTCCAACATTAGATAACAGAGTGTTGGCCATG
AACCAACCTCAAAGATTTCCATTGAGTAGAGGACAAGCACCCTCATTTCCTCACATCTCTCCTGTCCCATGTTCTAGGAA
ACCCTTCAAGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTGAGTAAAGGACCCCTCTTATCTCTGCTTTT
GGAAACCTGGGGAGGTGGAAGCCTTGGATGCAAGTGTTGGCTCAAACCTCCCAGCTCTGTGAATGAGGGCCTGTCTTCCA
CCATCTCTGAACTCCAGACACTCCAACAGTGAAAGGGATCTAGGGCCACCAAAGGGCTCAGCGAAGTCTCTTAACCTTTA
ATGTCCTGCAGGTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAACATGCAGTGTTT
TTTCTTCCTGCATTCCTAACTGGAGGATAAATTCCTGGGGACTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGCG
AGGTGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAATTACTGTTGGTCATGAAGCAACCCTGGCTGACTCAGCAGAGCA
AGAGCCTTGCCGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTC
AGGCTGTGCAGTTGGAATCCTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTTT
TTAATTATCTTACAGTGCTGTAGCTCAAAGTAGGAAGTGCATCTTACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCT
TCCCTCTGAGGATTCCAGGCAAGAATCTGCTTCTCACTTGTCCCAGCTTCTAAAGGCTCCCAGTTCCTTGGCTCCTGGTC
CCCTTCCTCCTTCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACC
TCTTTCTCTGAATGCTGCTCTCCCTTCTTCCTTATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAAT
CCATCATAATCTCCCGGAAATCATTCAGGATACCCTTGTTTTCAGTTCAGCTGACTAGCAACCGTAATTCCATCTGCAAT
CTTCATTCCTTCTTTCCATGTAAAATAAGATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGC
ATTCTCCTGCCTTCCACGAACGGTGAACAAGATGCATTTGGCCTCTGCTCTTGGGACACTGATATTGCAGATGGTTAAAT
GGGAGGACAGAAAATGAATGCACAAGTGGACCAATAAATGAATGATCCATTGGGAAGCATCTGTGCATGAAATCTATTTG
TTTGTTCGTTCATTTATTTATTGAGACAGAGTCTCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCAC
TGCAACCTGCGTCTCCTGGATCCAAGTGATTCTCCTGCCTCACCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCA
TGCCCGGCTAATTCTTTTTGTATATTTTTTGTAGAGAGGATGTTTCACCATGTTGGCCAAGCTTGTCTGAAACTCCCAAC
CTCAAGTGATCCGACCATCTCAGCAACCCAAAGTACTGGGATTACAGGCGTGAGCCACTTTGCCCAGCCAGAATTCAAAA
TAAATAATAGATAATGCTGAGTGTATAATTTTGGGTGACAGAGAAGGTCTCACTAATCAGATATTTGTGACATTAATGAA
AAACACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTTTCCACACACAGCTGTCAGCCGTGAAGGCAGAAAGCTGAAA
ACAATCTGATGTGGAAGGAAGAGGCTCTGCCTCAAATGCTGGGAATGAGGTGGGGAGAATGACAAGACGACTGTGGAGAG
ACGGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACC
TCGGGGTAGCCAGGAATCCCTACATGATTAATAGTGACTGACATGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCT
AGGAGACAGTGGAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACCCTAAGTGGATGAAGCAGATG
GATATAAGCTATGTTTGGGAGGTAGAATCATTTGCAGGGAGGGCTTGCTGGGTTTGAGTTTCCTAGTTGTTTAATCCTTG
CTAAATTAATTTCTTTCTGAGATTTATTCCTCCTACACATAAATCAATACCTGCCAAAGGAGTGACAGATATATGAGGGG
TGGTGGAAATGAAGGGACCTATTATAGCATAGTATACAAGTCTGTGAACGGTGGCTCACTCCTGTAACCCAGCACTGCAG
GAGGCTAAGGCCAGTGGATTCCAAGAAGTCAGGAGTTCGAGACCAGCCTGGCCAACATGGAGAAACCCTATCTCTACATG
GTGAAACCCTATCTCTCCTAAAAATACAAAAATTAGCCGAGCATGGTGGTGCATCCCTGTAATCCCAGCTCCTGCTCTGG
AGGATGAAGCAGGAGAATGACTTCAACCCAGGAGGTGGAGGTTGCAGTGAGTGGAGATCGCATCACTGCACTCCAGCCTG
GGTGACACAAGGAGACTCCATCTCAAAAAATAAAAATAAGAAATGCATAAATATAATAAAACACACACGAATGACAAAGG
CACCTGAATTCCCATCATCATTTTTCTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATCAGC
CTAAAACCTCTTCCGTATTTGGCTTTCTGTGAGCATGAGATCATATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCAC
AAATCCTGGAATAGAGAAAGTGCTCTGGTCATCACAAAAAAAACTTGCCCCCTCACCCAAATCCCCCATCTCACCCCTAC
TTCCAATCACCTGTGGAGATACAGATAGATCATGGGGAGGTAAATGCTAATACTCCTTGGAGTGAGTCCAGATCTTGGAA
TGAGAGATCAGCACCAGCACTAGCTCCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTATTGAAGCAATAGA
TAGTCGAGGGGGTGGTCCTTCCCCCAGCCTCTGAGGTAGAACAGCAGCCTAACATGTGTCTCCCGAGATCACAAAGAGTA
GCACATTTCACACGGGCTTCAACACTATTTTCTGGCTGTTTGACATAAGAGAATTCTACTTCGCTTTTTTTATATTGATT
TCACTTTTGTTTCCTTTTCTTGGAGAATGCAAGTTGTTTAACTCAAGAATGCCGTGGATGTAGAAATCCTAAAGCACATT
CGCTGTGTATCAATCCCAGTCCAGTCTTCCCAGAGAAGACTCTAAACACCTCCTGGACTGCACCTGGGCCTATGCCAATT
CCTATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAG
CAGCGAGTGACAACAGAAGCCTACATTTCAATGTGAGCCAGTTCCCCAAGGCTCAGAAAAGCTGCTCGAGACATGTGGAG
TCACCCCATTTGCAGTGTAGCTGGGGGAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCAC
TCAGCTAAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGGGACGATCCTCCTGAT
CTCAGGACTTTGCTGTCTTAGTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGGGTAACTTCTAAAGAAGAGATTG
GTTTGCCTCACCATTCTGCAGGCTGTACTGGAAGCATGGCACCAGCATCTATTTCTTATGATGGCCTCAGGCCGCTCCCA
CTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCACAGAGATCACACGGCAAGAGAGGGAGCAAGGGGGAGGGG
GAGCAATGGAGCTTCCAAGCTCTTTTTAACAACCAGCTCTCCAGGAACTAATAGAGAGGGAACTTGCTAACCCCGTCTCC
TTGGGACAGCATTGATCTGTTCATGATGGATCCACCTCCATGACCCAAACACCTCCCAAGAGGCCCAACCTCCCACACTG
GGGGTTAAATTTCAATGTGAGGTTTGAAGGGGTCAAACATCTCAACTAAAGTAGTTGTATCCTCAGCACGTTCCATGGTT
ACTATGAGAGCTATAACTGAGAAAGCAGGAGGAAGCTAGGTCTCCCGCCATCTGGGTGCTTGTCCGAAAGAGATGCTGTA
AGTGGTTACCTGTCAATCAAGAAATGCAAGACAATTCATATAGAGAAACTGCTATGATTAGCTTCTTACTGGTGTCTCCT
CTTCTTCCAGGTAACCCCAGACACCTGCACATTCTGATTGGGACCTCAGTGGTCATCATCCTCTTCATCCTCCTCCTCTT
CTTTCTCCTTCATCTCTGGTGCTCCAACAAAAAAAGTAAGTCTCACGGGGCACAGGCCAGAGAGCTCAGGGCCATGTGGG
GAAGCAGGATGGGAGCACACAGCTGTGTGTTCCTCACTGGCAGGATGGTCCCTGGCCCAAGACAGGAGCCACAGAGGCAG
GACTTTCTAGAGAGAGCACCAGACTCCCTGCCCCTGCCTTCAGCTCACAGACCGTTGCCTGATTCTGAACTGTATCCTCA
TGTCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGAGAGGCAGAAAGTGGGAGACAGAATCAATGGGATGGGAAC
TCAGAGCTATTCATGGGATGGGTCCTTGAGCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCA
GGCACCTATGGCCTCCCCCTGTTTGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTCTTTTGTTG
ACTTCCGTCTCCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGCCAACAGCGAGGTAGGTGCTC
CTCGGCCCAGCCTCGTGGCTAGTGTTATTCCCAAACAGTCCTGGAAAACGTGAGCACCCTCCCTCACTCAGCATTTCCCT
CCCTCACTCAGCATTTCCCTCTCTCCAGGACTCTGATGAACAAGACCCTCAGGAGGTGACATACGCACAGTTGGATCACT
GCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGACACCCCCTACAGATACCATCTTGTACACGGAA
CTTCCAAATGCTAAGCCCAGATCCAAAGTTGTCTCCTGCCCATGAGCACCACAGTCAGGCCTTGAGGACGTCTTCTAGGG
AGACAACAGCCCTGTCTCAAAACCGAGTTGCCAGCTCCCATGTACCAGCAGCTGGAATCTGAAGGCGTGAGTCTTCATCT
TAGGGCATCGCTCCTCCTCACGCCACAAATCTGGTGCCTCTCTCTTGCTTACAAATGTCTAGGTCCCCACTGCCTGCTGG
AAAGAAAACACACTCCTTTGCTTAGCCCACAGTTCTCCATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTT
ACTTCCTAGTCTACTTGAGGCTGCAATCACACTGAGGAACTCACAATTCCAAACATACAAGAGGCTCCCTCTTGACGTGG
CACTTACCCACGTGCTGTTCCACCTTCCCTCATGCTGTTTCACCTTTCTTCGGACTATTTTCCAGCCTTCTGTCAGCAGT
GAAACTTATAAAATTTTTTGTGATTTCAATGTAGCTGTCTCCTCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR