Allele Report for 3DL1*01701


3DL1*01701
Previous Designations & Local Names: 3DL1-KT-1
IPD Acc No: KIR00105
Assigned: 28-JUN-2003 Sequence Last Modified: 24-JAN-2005
Source Entries: AY366251 , AY760036 , GQ421736 , GU182356  
Cells Sequence Derived From: GM17146 , KT-NK , RSH , TAN-302  
Known Ethnic Origin Of Source: Black
Publications
Norman PJ et al. Nature Genetics 39:1092-9 2007. abstract
Artavanis-Tsakonas K et al. J Immunol 171:5396-405 2003. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 4 Laboratories: 3
Protein Sequence (444 aa)
MLLMVVSMACVGFFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPIFHGRLFQESF
NMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGI
SKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESV
TLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPS
SSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQ
LDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP
Nucleotide Sequence Data (1335 bps)
ATGTTGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGGTCCAGAGGGCCGGTCCACACATGGGTGGTCAGGA
CAAGCCCTTCCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACACGTGACTCTTCGGTGTCACTATCGTCATA
GGTTTAACAATTTCATGCTATACAAAGAAGACAGAATCCACGTTCCCATCTTCCATGGCAGATTATTCCAGGAGAGCTTC
AACATGAGCCCTGTGACCACAGCACATGCAGGGAACTACACATGTCGGGGTTCACACCCACACTCCCCCACTGGGTGGTC
GGCACCCAGCAACCCCGTGGTGATCATGGTCACAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGG
TGAAATCAGGAGAGAGAGTCATCCTGCAATGTTGGTCAGATATCATGTTTGAGCACTTCTTTCTGCACAAAGAGGGGATC
TCTAAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAATTTCTCCATCGGTCCCATGATGCT
TGCCCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACACCCCCTATCAGTTGTCAGCTCCCAGTGATCCCCTGG
ACATCGTGGTCACAGGTCCATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCAAGGTTCAGGCAGGAGAGAGCGTG
ACCTTGTCCTGTAGCTCCCGGAGCTCCTATGACATGTACCATCTATCCAGGGAGGGGGGAGCCCATGAACGTAGGCTCCC
TGCAGTGCGCAAGGTCAACAGAACATTCCAGGCAGATTTCCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TCGGCTCTTTCCGTCACTCTCCCTACGAGTGGTCAGACCCGAGTGACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCA
AGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTAACCCCAGACACCTGCACATTCTGATTGGGACCTCAGT
GGTCATCATCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTCATCTCTGGTGCTCCAACAAAAAAAATGCTGCTGTAATGG
ACCAAGAGCCTGCAGGGAACAGAACAGCCAACAGCGAGGACTCTGATGAACAAGACCCTGAGGAGGTGACATACGCACAG
TTGGATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGACACCCCCTACAGATACCATCTT
GTACACGGAACTTCCAAATGCTAAGCCCAGATCCAAAGTTGTCTCCTGCCCATGA
Genomic Sequence Data (14549 bps)
GTTCGGGAGGTTGGATCTAAGACGTGTTTTGAGTTGGTCATAGTGAAGGACGCGAGGTGTCAATTCTAGTGAGAGCAATT
TCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCCT
CCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCG
CGGCCGCCTGTCTGCACCGGCAGCACCATGTTGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAAT
CGAGGGAGGGAGTGCGGGGATGGAGATCTGGACCTGGAGGTAAAGATATGGGCCTAGAGGTGGAGTTATGGGCCTGGAGG
TGGAGTTATGGGCCTGAAGTGGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATAGGGGCCTGGGGTGGA
GATATGTGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATATGTGCCTGGGGTGGAGATA
TGGGCCTGGAGGGGAGATATGGATGGGCCTGGAGGGGAGATGTGGGCCTAGAGGTGGAGTGATGGGCCTAGAAGTGGAGC
GATGGGCCTGGAGTGGAGATATGGGCCTGGAGGTGGAGTTATGGGCCTGCAGTAGAGATATGGGCCTGAAGTGGAGATAT
GGGCCTGGAGTGGAGATATGGGCCTAGAGGTGGAGTTATGGGCCCGGAGGTGGAGTTAAGGGCATGAAGTGGAGATCTGG
GCCTGGAGTGGAGATATGATCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATACGGGCCTGGAGCAGACATACAAGCCT
GGAAAGGAGATATGGGCCTGGAGAGGAGATAGAAGCCTGGAGTGGAAATATGGGCCTGGAGTGGAGATATGAGCCTGGAG
TGGATATATGAGCCTGGAGTTGAGATAGGAGCCTGGAGTGGAGATATGGGCCTGGAGTGGACTTATCAGCCTGGAGAGGA
GATATGGGTCTGGAGTGGAGATACGGACCTGGAGTGGAGATCTGGGCCTGTTGTGTAGATCTAGGCCTGGAGGTAGAGAT
CTGGGCCTGGAGGCTGAGTCTCTGCACAGCCGAGATCCTTGTTCCTGGGGGCAGGTAGGCAGCGAGGGTGAGTTTACCTT
CAGCCCAGCAAGGGCCTGGCTGCCAAGACGCACAGCCCAGTGGGGGCAGCAGGGTGCCCTGGTTTGCCTGCAGATGGATG
GTCCATCATGATCTTTCTTTCTAGGGTTCTTCTTGGTCCAGAGGGCCGGTCCACACATGGGTGAGTCCTTCCCCAAACCT
TAGGGTGTCATCTCCCCACATAAGAGGATTTTCCTGAAATGGGAGGGAAGTCCTGTCGGGGAGTCTCTCATAAACTAGGA
AGAGGGGACCCTCGGATGCTCGGCCCACATTTCTGACCTTGCCCTCCCCGGCCTTTCTTTCCCTTTCCTGAGTCAAGCTC
TGTGAAGACTGGGGTGAGACTAGGGTGCTCCAAGATGGGTGTGCAGGGAGGAAGTGGTGTCAGCAGCAGAGAAAGAGAGG
GAAGCAGTGCTAGGAACAGCAGGTCCTCTGAGGACAAAGGTGTAACTCACACCCTCCAGCGTTTCCGTGATGGTAGGGGC
TGCAGTGTGGCTGTGGTCTTTCTACCAGAAAAGGTGAGGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGATGG
GGGCTCAGTTCATCAATTGGCTGATATTCCATTCACATAGGACTTGCCCTCCATGCCGTGTCTACTTTGTGTTGTTTTAT
ATGAGTAATTTTGCAGTATTAAAATCTAGTAAGAGTTGCTTCTCCAGCACTTGCTCAAAGTTCTCAGCTGACACTTGTTG
TAGGGAGACGCCATGTCTATGCAGGATGGGTCCTTCCTGTAGCCCTGGGCACCCAGGTGTGGTAGGAGCCTTAGAAAGTG
GAAATGGGGAGAATCTTCTGGGCACTGGGAGTGAGGGGCGGCTCCACATCCTCCTCTCTAAGGCAGTGCCTCCTTCTCCC
CCAGGTGGTCAGGACAAGCCCTTCCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACACGTGACTCTTCGGTG
TCACTATCGTCATAGGTTTAACAATTTCATGCTATACAAAGAAGACAGAATCCACGTTCCCATCTTCCATGGCAGATTAT
TCCAGGAGAGCTTCAACATGAGCCCTGTGACCACAGCACATGCAGGGAACTACACATGTCGGGGTTCACACCCACACTCC
CCCACTGGGTGGTCGGCACCCAGCAACCCCGTGGTGATCATGGTCACAGGTCAGAGGCTTTCCGTCTGGGCTTCTCACTG
TCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGGGTGTCCGTCAGGGTCCCATCACCCAGGCCCTGACTGTATTTGGGGT
CAAGGGAGATTGAATACAGGGGAAATGGGTGCTGTGGTGGGAAGAATCACTGTCCCCAATGATGGCTACATTGTAATCCC
TGGAGCCTGTGACTATTTATGTTACAGGGCAGGGGACTGAAGGGGAAGGTGGAGCTCAGGTTGTTGATGAGTTGACCTTG
AGATGGGGAGACAGCCTGGACTGTCCCACTGGGCTCAGTGTAATCACAAGGGTCCACATGAGAGGTGGAGGAAGAGGGGA
GTGGGGATTAGAGCAGTGTAGTGGGAGGGAGACGCTATCAGCCACTGCGGGCTTTGAAGGTGGAGGAAGACCACTAGTCA
CAGAATGCAGGTGGCCTCTAAGGGCTGGAGAAGTCAAGAGAACTGATTCGCTGATTCTCCAGAGGGAACGCAGCCCTGTA
GACACCTTGATTTCAGCACAGGGAGAACTGGATCCAATTTCTGTCTCCAGAAGTGGAAGGGGTCAGTGTGTTCTCTCCCG
CTGCCATGTTTGTGGTAATTTTCTGCAGCAGCAACAGGAAACCAACACAGGAACCCAGGTCAAGGACAAGTTAGGAAACC
AAACAAGGATAGCCAGATGTGGTGGTGGGCGCGAGTAATCCAACGACTGGGGAGGCTGAGGCAAGAGAATCACTTGAACT
GGGGATTTGTTCAAAAGAGATTGATTCAGGCTGCTAAGAGCCTGGACATGCAGCCTGTCCTCTTCCACCCCCACATAGAC
AGCAGGAAAGAGATTAGTGGGAAACAGATACAACAGCCCAAGAGATGAGGCTGTCTTCACAGTGGCAAGGGAGTCAGGGG
CTACTGGAGACAGAGGGACAGAGAAGAGGGAGGAAGACAGATGGAGGCACCTGCACCAGGGGATATGGGCACAGAAAAGA
CACGGAGATGCAGAGAGGGAGGAGAGAGACAGACACGGGGAGGGGAACCCTCACTCATTCCAGGTGCCATGGATGGGATG
ATAAAGAGAGATGCCTTCTAAACTCACAACTTCTCTTTCTAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGT
CCCCTGGTGAAATCAGGAGAGAGAGTCATCCTGCAATGTTGGTCAGATATCATGTTTGAGCACTTCTTTCTGCACAAAGA
GGGGATCTCTAAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAATTTCTCCATCGGTCCCA
TGATGCTTGCCCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACACCCCCTATCAGTTGTCAGCTCCCAGTGAT
CCCCTGGACATCGTGGTCACAGGTGAGAGTGTCTAGACATTGTTCTCATTGTCACTGGGACACAGAGTGAATGATCCAGG
ACTTGGAACCCCCAGGTGGTCATGAGGAAGATAAGTGTGGGATTCTTATGGAAAGAGAGTGACTTGGTGAGGTCTGTACC
AACAGAGACAGAGAAACAGGAGACATAAGTACAGAACAGGTGTCATAACAGAGGACAGACACAGGGGCCATACAGGGAGG
TAGAAAAGAGAGAAAGAGGTAAAGGAGACACTCAGACAGACAGACATGTCCCAGAGAGAGGTGTCCTTCCATGCTGACTT
TGCTCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTGTTCCTACCAGAAGAACCCAAGGA
CACCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGCCACCTACAGATGCCGTGTTTATTCTGACACC
TCTGCCTTCCATGCAATGGAGAGTAATCATCCCAGGATATCATGGCCCCTGAACACCAACCCCTGTATGCTGTGTGAACT
TGGGGTCCCCAGACTGGATTCTGAGGCTCATATTCCAAATAATCCCACATATGATAGGATCGCTGAGAGACACAGAGAAA
AATCAGGGACACCAAAAAACAAAGACATAAACACACACAAAATGAGCCAGAAGAAGGAGATTAAGAGATTCACAGACACA
TAAAAAGAAAGAAAAGAGGGCAGAATGGAGAGAATGATGGAAAGGAGGAGAGAAAAGCCCCAAAATCAGAACCCTGAGGG
AGGGACACAAAGACAGAGAAAGATAAATATGTGGGGATGGATTGCAGAGATTCCAAATAGAACTAGAGAGACTGAGAGGC
AGAGAAAGACAAGGAGACGGAGAGAGAGAGATGATAGATGGATAGATAGACGTAGATAGATGATAAATAGGTAGATGATA
GATAATGGATTGGTTATAGATACATAGATGATGACTGATAGATGATACATAGAGATGACGATGATGATGATAGACACATA
GATATATACATAGATGATACATAAATAGAGACAGAGAGGCAGACAGAGAGGTAATAGAGAGAGAGATAGATGATACATAT
ATAGATAATAGATGATTGATGGATAGATAGACAGATAGACAATTGATAGAGAGATAGATAAGTGATACATAAATATAGAT
GATAGATAATTTGTAGATAGACACAAAATAGATAAATAGATAGAAATGTGCAGAAAGTTATGAACAAGACAGAAAGTGAG
AGACTCAAAATTAAAGAAAAAGGAAGATCAAGTCAACCAATCCAAGGAGGGTCAGAGAGAATAAAACAATCCAAAAAGGG
AAAACATACCTCAGGGTGGGGAAGTGAGGTCATAGACCTAGAGAGACAGAAAAGGTAGAAGGAGGAAACAGATATGAAGA
GAGATGGGGTGGAGGGTGAGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTATGAG
GGGAGCTATGACAAGGAAGAACCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCCATATGAGAAACCTTCTCTCTCA
GCCCAGCCGGGCCCCAAGGTTCAGGCAGGAGAGAGCGTGACCTTGTCCTGTAGCTCCCGGAGCTCCTATGACATGTACCA
TCTATCCAGGGAGGGGGGAGCCCATGAACGTAGGCTCCCTGCAGTGCGCAAGGTCAACAGAACATTCCAGGCAGATTTCC
CTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTCACTCTCCCTACGAGTGGTCAGACCCG
AGTGACCCACTGCTTGTTTCTGTCACAGGTGAGAAAAGCCCATATCTCTCTCATGTCCTATGATCCTAAATCCTTAGCTA
AGGAGCTTCCTGCTGATGATGGAGAAAAGCATGGACAGATGCAGAGAGAAGACACAGCAGGTGTGAGGGCGGAGTCAGGG
CGCAGGATGGCAGACAGGGCACCTCCAAACCCTCCTTCATGGCCTGCATGGAGGCCTCCGATCAGGGCTCCAGGCACCCA
GGCAGATGGAGAAAGCGGTCAGGACAGACCCAGAGAAGGGGAGACTGGGCTTAGTTTGGGGAGATCAGAGGTTCCCTCAG
CCCCTCAATCTTATCCATTTCCCAGAAGCCCATCATGGCCTCTCACCCACACAGAGAGATATCATCACCAGCAACCCCTA
CACCCTTTTCTTTTCATTTTCAAAAATATTTATTGAGGTTAAATGTAACTATATAATTTACCACCTTTACCATTTTTAAA
AGTAAAATCTAGTGGTCATAAATACCTTTATATGCTGGGTGTGGTGGTTCACGGTTGTAATCTCGGCGCTTTGAGAGGCC
AAGGAAGGTGGATCATTTAAGATCAGGAACTCGAGATCACCCTGGCCAACATGTGGGAAATTCATCTTTACTAAACAGAC
AAGAAAAATTAGCCGAGCATGCTGGCATGCACCTGTAGTCCTAGCTACTTGGGAGGCTGAGGCAGGAGAAGCACTTAAAC
CCAGGAGGCAGAGGTTGCACTGAGCCGAGATCATGCCACTGCACTGCAGCCTGGGAGACAGAGAGAGACTCTGTTTCTAA
ATAAATAAATACATCTATATTCTTTTTTTTGTTACCCTCCACCCTTCCCTTCCTGGCCTCTGGTGTCCACCATTGTATTC
TCCACCTTCATGAGATCCACCTTTTATCTCCTGCATGTGGGTGAGAAATGGGAATCTTTGTAATGACCTCCAGTTCCATC
CATGTGGCTGCAAATGACAGGATGTTATTGTTTCTATGGATGAGTAGTCTCCACTGTGTGTGTGTACCACAGTTCTCTAT
CCATTCACCCACTGATGGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGGAACAGTCATATGAGTGC
AGATATCACTTCGATACACTGATGTCCTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGACACTATGAAAGTTCT
CTTTTTTTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGTCCAAGCTGGAGTCTAAGTGGTGAGATCTTGGCTCAT
TGCAACCTGTGCCTCCTAGGTTCAAATGATTGTCCTGACTCAGCCTCCCTAGTAGCTGTGATTACAGGTGCACGCCACCA
TGCCTGGCTAATTTTTGTATTTTTTTAGCACAGACGGGATATCCCAATTTTGGGCAGGCTGCTCTCAAACTCCTGACCTC
AAGTGAGGTGCCTGCCTCGGTTTCCCAAAGTGCTGAAGTTACAGGCATAAGCCACTATGCCCAGCCTCCTTTTAGTTTTT
TAAAGAATTTCCATACTTTTCTCCATAATAGTTGTACTAATTTACATTCCTACCAACAGGGTACCAGGGTTCTCCTTTCT
CTACCATCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGTAAAAGCCATTTTACTTTACTTTATTTTATTTATTTATTTAT
GTTGAGATGGAGTTTCACTCATAGTCTCCCAGGCTGGAGTGCAAGGGTGTGATCTCAGCTCACTGCAACCTCCGCCTCCC
GCGTTCAACTGATTCTCCTGCCTCAGCCTCCAAAGTAGCTGGGATTACAGGCATGTGCCACCACGCCTAGCTAATTTTTG
TATGTTTAGTAGAGAGGGAGTTTCTCCATGATGGTCAGGCTGGTCTCCCGACCTCAGGTGATCCGCCCACCTCCGCCTCC
TGAAGTGCCGGAATTACAGGCGTGAGCCACCGGCCTAAAAGGCATTTTAATGGGATGAGATGAAAACTCATCGCGATTGT
AATTTACATTTCTCTGATGATGAGTGATGCCGAGTACTTTTTCATATACGTGATCGCCATTTCTATGTTTTGTTTGTGGA
GAAATGTCTCCTCATGTCTTTTGCTCGTTTTTTAATTAAATTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCCAGTT
ATTAATCCCGTCTCAGATGAATAGTTTGCAAATATTTGCTCCTATTTTGTCGGTTGTCTCTTCACTTTCTTGGTTTATCT
TTTGTGGTGCAGAAGTTGCTTGGTTTGATGTAATCCTAATGGTCTATTTTTTGCTTTGATTACTTGTGTTTTGAAGGTTT
TAAACAAAATGTCTTTCGTCAGACAAATGTCTTCCCCATTATTTTCTTCTACATGTTTCATAGGTTCAGGCCTTAGACTC
ATGTTTTTAATCCATTTTCATTTGATTTTTGTGTATGGTGACAGGTATAGATGCAGTTTTATTCCTCTGCATGTAGATAT
CCAGTTTTCCCCACACCATTTATTGAAAAGACTGTCCTTTCCTGATTGTAAGTTCTCGGCACCTTTGTCAAAGTCCATTA
AATGGGCTGGGTATGGTGGCTCACACCTGCAATTCCAGCACTTTGGGAGGCCGAGGCGGGTGGATCACCTGAAGCCAGGA
GTTCAAGATCAGGCTGGCCAACAGAGTGAAACCTCGTCTCTACTAAAAATACAAAAATTAGCTGAGCATGGTGACCAGTG
CCTGTAATACCACTACTCGGGTGTTTGAGGCAAGAGAATTGCTTGAATCCAGGAAGTGGAGGTTGCATTGAGCTGAGATT
GCACCTCTGCACTCCAGCCTGCATGACAGAGCAAGATTCTAACACACACACACACAAAAAAAGCCATTGGATGTAAATGC
ATGGATTATATCTGTGTTCTCCATTCTGTTTCATTTTTTATGTGCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTAC
TACAGCTCTGTAACATATTTCTAAGTCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTCAAGTCTCAAGACAGTG
GGCATCGCACACAAAAATTATGGAGAAGAGGATCCCAAGACTCCCAGGGTCCAACATTAGATAACAGAGTGTTGGCCATG
AACCAACCTCAAAGATTTCCATTGAGTAGAGGACAAGCACCCTCATTTCCTCACATCTCTCCTGTCCCATGTTCTAGGAA
ACCCTTCAAGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTGAGTAAAGGACCCCTCTTATCTCTGCTTTT
GGAAACTTGGGGAGGTGGAAGCCTTGGATGCAAGTGTTGGCTCAAACCTCCCAGCTCTGTGAATGAGGGCCTGTCTTCCA
CCATCTCTGAACTCCAGACACTCCAACAGTGAAAGGGATCTAGGGCCACCAAAGGGCTCAGCGAAGTCTCTTAACCTTTA
ATGTCCTGCAGGTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAACATGCAGTGTTT
TTTCTTCCTGCATTCCTAACTGGAGGATAAATTCCTGGGGACTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGCG
AGGTGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAATTACTGTTGGTCATGAAGCAACCCTGGCTGACTCAGCAGAGCA
AGAGCCTTGCCGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTC
AGGCTGTGCAGTTGGAATCCTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTTT
TTAATTATCTTACAGTGCTGTAGCTCAAAGTAGGAAGTGCATCTTACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCT
TCCCTCTGAGGATTCCAGGCAAGAATCTGCTTCTCACTTGTCCCAGCTTCTAAAGGCTCCCAGTTCCTTGGCTCCTGGTC
CCCTTCCTCCTTCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACC
TCTTTCTCTGAATGCTGCTCTCCCTTCTTCCTTATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAAT
CCATCATAATCTCCCGGAAATCATTCAGGATACCCTTGTTTTAAGTTCAGCTGACTAGCAACCGTAATTCCATCTGCAAT
CTTCATTCCTTCTTTCCATGTAAAATAAGATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGC
ATTCTCCTGCCTTCCACGAACGGTGAACAAGATGCATTTGGCCTCTGCTCTTGGGACACTGATATTGCAGATGGTTAAAT
GGGAGGACAGAAAATGAATGCACAAGTGGACCAATAAATGAATGATCCATTGGGAAGCATCTGTGCATGAAATCTATTTG
TTTGTTCGTTCATTTATTTATTGAGACAGAGTCTCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCAC
TGCAACCTGCGTCTCCTGGATCCAAGTGATTCTCCTGCCTCACCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCA
TGCCCGGCTAATTCTTTTTGTATATTTTTTGTAGAGAGGATGTTTCACCACGTTGGCCAAGCTTGTCTGAAACTCCCAAC
CTCAAGTGATCCGACCATCTCAGCAACCCAAAGTACTGGGATTACAGGCGTGAGCCACTTTGCCCAGCCAGAATTCAAAA
TAAATAATAGATAATGCTGAGTGTATAATTTTGGGTGACAGAGAAGGTCTCACTAATCAGATATTTGTGACATTAATGAA
AAACACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTTTCCACACACAGCTGTCAGCCGTGAAGGCAGAAAGCTGAAA
ACAATCTGATGTGGAAGGAAGAGGCTCTGCCTGAAATGCTGGGAATGAGGTGGGGAGAATGACAAGACGACTGTGGAGAG
ACGGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACC
TCGGGGTAGCCAGGAATCCCTACATGATTAATAGTGACTGACATGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCT
AGGAGACAGTGGAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACCCTAAGTGGATGAAGCAGATG
GATATAAGCTATGTTTGGGAGGTAGAATCATTTGCAGGGAGGGCTTGCTGGGTTTGAGTTTCCTAGTTGTTTAATCCTTG
CTAAATTAATTTCTTTCTGAGATTTATTCCTCCTACACATAAATCAATACCTGCCAAAGGAGTGACAGATATATGAGGGG
TGGTGGAAATGAAGGGACCTATTATAGCATAGTATACAAGTCTGTGAACGGTGGCTCACTCCTGTAACCCAGCACTGCAG
GAGGCTAAGGCCAGTGGATTCCAAGAAGTCAGGAGTTCGAGACCAGCCTGGCCAACATGGAGAAACCCTATCTCTACATG
GTGAAACCCTATCTCTCCTAAAAATACAAAAATTAGCCGAGCATGGTGGTGCATCCCTGTAATCCCAGCTCCTGCTCTGG
AGGATGAAGCAGGAGAATGACTTCAACCCAGGAGGTGGAGGTTGCAGTGAGTGGAGATCGCATCACTGCACTCCAGCCTG
GGTGACACAAGGAGACTCCATCTCAAAAAATAAAAATAAGAAATGCATAAATATAATAAAACACACACGAATGACAAAGG
CACCTGAATTCCCATCATCATTTTTCTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATCAGC
CTAAAACCTCTTCCGTATTTGGCTTTCTGTGAGCATGAGATCATATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCAC
AAATCCTGGAATAGAGAAAGTGCTCTGGTCATCACAAAAAAAACTTGCCCCCTCACCCAAATCCCCCATCTCACCCCTAC
TTCCAATCACCTGTGGAGATACAGATAGATCATGGGGAGGTAAATGCTAATACTCCTTGGAGTGAGTCCAGATCTTGGAA
TCAGAGATCAGTGCCAGCACTAGCTCCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTATTGAAGCAATAGA
TAGTCGAGGGGGTGGTCCTTCCCCCAGCCTCTGAGGTAGAACAGCAGCCTAACATGTGTCTCCCGAGATCACAAAGAGTA
GCACATTTCACACGGGCTTCAACACTATTTTCTGGCTGTTTGACATAAGAGAATTCTACTTCGCTTTTTTTATATTGATT
TCACTTTTGTTTCCTTTTCTTGGAGAATGCAAGTTGTTTAACTCAAGAATGCCGTGGATGTAGAAATCCTAAAGCACATT
CGCTGTGTATCAATCCCAGTCCAGTCTTCCCAGAGAAGACTCTAAACACCTCCTGGACTGCACCTGGGCCTATGCCAATT
CCTATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAG
CAGCGAGTGACAACAGAAGCCTACATTTCAATGTGAGCCAGTTCCCCAAGGCTCAGAAAAGCTGCTCGAGACATGTGGAG
TCACCCCATTTGCAGTGTAGCTGGGGGAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCAC
TCAGCTAAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGGGACGATCCTCCTGAT
CTCAGGACTTTGCTGTCTTAGTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGGGTAACTTCTAAAGAAGAGATTG
GTTTGCCTCACCATTCTGCAGGCTGTACTGGAAGCATGGCACCAGCATCTATTTCTTATGATGGCCTCAGGCCGCTCCCA
CTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCACAGAGATCACACGGCAAGAGAGGGAGCAAGGGGGAGGGG
GAGCAATGGAGCTTCCAAGCTCTTTTTAACAACCAGCTCTCCAGGAACTAATAGAGAGGGAACTTGCTAACCCCGTCTCC
TTGGGACAGCATTGATCTGTTCATGATGGATCCACCTCCATGACCCAAACACCTCCCAAGAGGCCCAACCTCCCACACTG
GGGGTTAAATTTCAATGTGAGGTTTGAAGGGGTCAAACATCTCAACTAAAGTAGTTGTATCCTCAGCACGTTCCATGGTT
ACTATGAGAGCTATAACTGAGAAAGCAGGAGGAAGCTAGGTCTCCCGCCATCTGGGTGCTTGTCCGAAAGAGATGCTGTA
AGTGGTTACCTGTCAATCAAGAAATGCAAGACAATTCATATAGAGAAACTGCTATGATTAGCTTCTTACTGGTGTCTCCT
CTTCTTCCAGGTAACCCCAGACACCTGCACATTCTGATTGGGACCTCAGTGGTCATCATCCTCTTCATCCTCCTCCTCTT
CTTTCTCCTTCATCTCTGGTGCTCCAACAAAAAAAGTAAGTCTCACGGGGCACAGGCCAGAGAGCTCAGGGCCATGTGGG
GAAGCAGGATGGGAGCACACAGCTGTGTGTTCCTCACTGGCAGGATGGTCCCTGGCCCAAGACAGGAGCCACAGAGGCAG
GACTTTCTAGAGAGAGCACCAGACTCCCTGCCCCTGCCTTCAGCTCACAGACCGTTGCCTGATTCTGAACTGTATCCTCA
TGTCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGAGAGGCAGAAAGTGGGAGACAGAATCAATGGGATGGGAAC
TCAGAGCTATTCATGGGATGGGTCCTTGAGCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCA
GGCACCTATGGCCTCCCCCTGTTTGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTCTTTTGTTG
ACTTCCGTCTCCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGCCAACAGCGAGGTAGGTGCTC
CTCGGCCCAGCCTCGTGGCTAGTGTTATTCCCAAACAGTCCTGGAAAACGTGAGCACCCTCCCTCACTCAGCATTTCCCT
CCCTCACTCAGCATTTCCCTCTCTCCAGGACTCTGATGAACAAGACCCTGAGGAGGTGACATACGCACAGTTGGATCACT
GCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGACACCCCCTACAGATACCATCTTGTACACGGAA
CTTCCAAATGCTAAGCCCAGATCCAAAGTTGTCTCCTGCCCATGAGCACCACAGTCAGGCCTTGAGGACGTCTTCTAGGG
AGACAACAGCCCTGTCTCAAAACCGAGTTGCCAGCTCCCATGTACCAGCAGCTGGAATCTGAAGGCGTGAGTCTTCATCT
TAGGGCATCGCTCCTCCTCACGCCACAAATCTGGTGCCTCTCTCTTGCTTACAAATGTCTAGGTCCCCACTGCCTGCTGG
AAAGAAAACACACTCCTTTGCTTAGCCCACAGTTCTCCATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTT
ACTTCCTAGTCTACTTGAGGCTGCAATCACACTGAGGAACTCAGAATTCCAAACATACAAGAGGCTCCCTCTTGACGTGG
CACTTACCCACGTGCTGTTCCACCTTCCCTCATGCTGTTTCACCTTTCTTCGGACTATTTTCCAGCCTTCTGTCAGCAGT
GAAACTTATAAAATTTTTTGTGATTTCAATGTAGCTGTCTCCTCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR