Allele Report for 3DL1*0050102


3DL1*0050102
Previous Designations & Local Names: RSH_BA2
IPD Acc No: KIR00456
Assigned: 28-AUG-2009 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182344 , GU182345 , GU182357  
Cells Sequence Derived From: FH13 , RSH  
Known Ethnic Origin Of Source: Black
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 2 Laboratories: 1
Protein Sequence (444 aa)
MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESF
NMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGI
SKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTSYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESV
TLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYELSDPSDPLLVSVTGNPS
SSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQ
LDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP
Nucleotide Sequence Data (1335 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTGTTCTTGGTCCAGAGGGCCGGTCCACACATGGGTGGTCAGGA
CAAACCCTTCCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACACGTGACTCTTCGGTGTCACTATCGTCATA
GGTTTAACAATTTCATGCTATACAAAGAAGACAGAATCCACATTCCCATCTTCCATGGCAGAATATTCCAGGAGAGCTTC
AACATGAGCCCTGTGACCACAGCACATGCAGGGAACTACACATGTCGGGGTTCACACCCACACTCCCCCACTGGGTGGTC
GGCACCCAGCAACCCCGTGGTGATCATGGTCACAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGG
TGAAATCAGGAGAGAGAGTCATCCTGCAATGTTGGTCAGATATCATGTTTGAGCACTTCTTTCTGCACAAAGAGGGGATC
TCTAAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAATTTCTCCATCGGTCCCATGATGCT
TGCCCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACACCTCCTATCAGTTGTCAGCTCCCAGTGATCCCCTGG
ACATCGTGGTCACAGGTCCATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCAAGGTTCAGGCAGGAGAGAGCGTG
ACCTTGTCCTGTAGCTCCCGGAGCTCCTATGACATGTACCATCTATCCAGGGAGGGGGGAGCCCATGAACGTAGGCTCCC
TGCAGTGCGCAAGGTCAACAGAACATTCCAGGCAGATTTCCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TTGGCTCTTTCCGTCACTCTCCCTACGAGTTGTCAGACCCGAGTGACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCA
AGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTAACCCCAGACACCTGCACATTCTGATTGGGACCTCAGT
GGTCATCATCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTCATCTCTGGTGCTCCAACAAAAAAAATGCTGCTGTAATGG
ACCAAGAGCCTGCAGGGAACAGAACAGCCAACAGCGAGGACTCTGATGAACAAGACCCTGAGGAGGTGACATACGCACAG
TTGGATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGACACCCCCTACAGATACCATCTT
GTACACGGAACTTCCAAATGCTAAGCCCAGATCCAAAGTTGTCTCCTGCCCATGA
Genomic Sequence Data (14547 bps)
GTTCGGGAGGTTGGATCTGAGACGTGTTTTGAGTTGGTCATAGTGAAGGACGCGAGGTGTCAATTCTAGTGAGAGCAATT
TCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCCT
CCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCGAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCG
CAGCCGCCTGTCTGCACCGGCAGCACCATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAAT
CGAGGGAGGGAGTGAGGGGATGGAGATCTGGACCTGGAGGTAAAGATATGGGCCTAGAGGTGGAGTTATGGGCCTAGAGG
TGGAGTTATGGGCCTGAAGTGGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATAGGGGCCTGGGGTGGA
GATATGTGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATATGTGCCTGGGGTGGAGAGA
TGGGCCTGGAGGGGAGATATGGGCCTGGAGGGGAGATGTGGGCCTAGAGGTGGAGTGATGGGCCTAGAAGTGGAGCGATG
GGCCTGGAGTGGAGATATGGGCCTGGAGGTGGAGTTATGGGCCTGCAGTAGAGATATGGGCCTGAAGTGGAGATATGGGC
CTGGAGTGGAGATATGGGCCTAGAGGTGGAGTTATGGGCCCGGAGGTGGAGTTAAGGGCATGAAGTGGAGATCTGGGCCT
GGAGTGGAGATATGATCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATACGGGCCTGGAGCAGACATACAAGCCTGGAA
AGGAGATATGGGCCTGGAGAGGAGATAGAAGCCTGGAGTGGAAATATGGGCCTGGAGTGGACTTACCAGCCTGGAGAGGA
GATATGGGCCTGGAGTTGAGATAGGAGCCTGGAGTGGAGATATGGGCCTGGAGTGGACTTACCAGCCTGGAGAGGAGATA
TGGGCCTGGAGTGGAGATACGGACCTGGAGTGGAGATCTGGGCCTGTTGTGTAGATCTAGGCCTGGAGGTAGAGATCTGG
GCCTGGAGGCTCAGTCTCTGCACAGCCGAGATCCTTGTTCCTGGGGGCAGGTAGGCAGCGAGGGTGAGTTTACCTTCAGC
CCAGCAAGGGCCTGGCTGCCAAGACGCACAGCCCAGTGGGGGCAGCAGGGTGCCCTGGTTTGCCTGCAGATGGATGGTCC
ATCATGATCTTTCTTTCTAGGGTTGTTCTTGGTCCAGAGGGCCGGTCCACACATGGGTGAGTCCTTCCCCAAACCTTAGG
GTGTCATCTCCCCACATAAGAGGATTTTCCTGAAATGGGAGGGAAGTCCTGTCGGGGAGTCTCTCATACACTAGGAAGAG
GGGACCCTCGGATGCTCGGCCCACATTTCTGACCTTGCCTTCCCCGGCCTTTCATTCCCTTTCCTGAGTCAAGCTCTGTG
AAGACTGGGGTGAGACTAGGGTGCTCCAAGATGGGTGTGCAGGGAGGAAGTGGTGTCAGCAGCAGAGAAAGAGAGGGAAG
CAGTGCTAGGAACAGCAGGTCCTCTGAGGACAAAGGTGTAACTCACACCCTCCAGCGTTTCCGTGATGGTAGGGGCTGCA
GTGTGGCTGCGGTCTTTCTACCAGAAAAGGTGAGGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGATGGGGGC
TCAGTTCATCAATTGGCTGATATTCCATTCACATAGGACTTGCCCTCCATGCCGTGTCTACTTTGTGTTGTTTTATATGA
GTAATTTTGCAGTATTAAAATCTAGTAAGAGTTGCTTCTCCAGCAACTTGCTCAAAGTTCTCAGCTGACACTTGTTGTAG
GGAGACGCCAAGTCTATGCAGGATGGGTCCTTCCTGTAGCCCTGGGCACCCAGGTGTGGTAGGAGCCTTAGAAAGTGGAA
ATGGGGAGAATCTTCTGGGCACTGGGAGTGAGGGGCGGCTCCACATCCTCCTCTCTAAGGCAGTGCCTCCTTCTCCCCCA
GGTGGTCAGGACAAACCCTTCCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACACGTGACTCTTCGGTGTCA
CTATCGTCATAGGTTTAACAATTTCATGCTATACAAAGAAGACAGAATCCACATTCCCATCTTCCATGGCAGAATATTCC
AGGAGAGCTTCAACATGAGCCCTGTGACCACAGCACATGCAGGGAACTACACATGTCGGGGTTCACACCCACACTCCCCC
ACTGGGTGGTCGGCACCCAGCAACCCCGTGGTGATCATGGTCACAGGTCAGAGGCTTTCCGTCTGGGCTTCTCACTGTCC
CACCTCCTGAATCCCAGAGCTTCTGGTGGGGGTGTCCGTCAGGGTCCCATCACCCAGGCCCTGACTGTATTTGGGGTCAA
GGGAGATTGAATACAGGGGAAATGGGTGCTGTGGTGGGAAGAATCACTGTCCCCAATGATGGCTACATTGTAATCCCTGG
AGCCTGTGACTATTTATGTTACAGGGCAGGGGACTGAAGGGGAAGGTGGAGCTCAGGTTGTTGATGAGTTGACCTTCAGA
TGGGGAGACAGCCTGGACTGTCCCACTGGGCTCAGTGTAATCACAAGGGTCCACATGAGAGGTGGAGGAAGAGGGGAGTG
GGGATTAGAGCAGTGTAGTGGGAGGGAGACGCTATCAGCCACTGCGGGCTTTGAAGGTGGAGAAAGACCACTAGTCACAG
AATGCAGGTGGCCTCTAAGGGCTGGAGAAGTCAAGAGAACTGATTCGCTGATTCTCCAGAGGGAACGCAGCCCTGTAGAC
ACCTTGATTTCAGCACAGGGAGAACTGGATCCAATTTCTGTCTCCAGAAGTGGAAGGGGTCAGTGTGTTCTCTCCCGCTG
CCATGTTTGTGGTAATTTTCTGCAGCAGCAACAGGAAACCAACACAGGAACCCAGGTCAAGGACAAGTTAGGAAACCAAA
CAAGGATAGCCAGATGTGGTGGTGGGCGCGAGTAATCCAACGACTGGGGAGGCTGAGGCAAGAGAATCACTTGAACTGGG
GATTTGTTCAAAAGAGATTGATTCAGGCTGCTAAGAGCCTGGACATGCAGCCTGTCCTCTTCCACCCCCACATAGACAGC
AGGAAAGAGATTAGTGGGAAACAGATACAACAGCCCAAGAGATGAGGCTGTCTTCACAGTGGCAAGGGAGTCAGGGGCTA
CTGGAGACAGAGGGACAGAGAAGAGGGAGGAAGACAGATGGAGGCACCTGCACCAGGGGATATGGGCACAGAAAAGACAC
GGAGATGCAGAGAGGGAGGAGAGAGACAGACACGGGGAGGGGAACCCTCACTCATTCCAGGTGCCATGGATGGGATGATA
AAGAGAGATGCCTTCTAAACTCACAACTTCTCTTTCTAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCC
CTGGTGAAATCAGGAGAGAGAGTCATCCTGCAATGTTGGTCAGATATCATGTTTGAGCACTTCTTTCTGCACAAAGAGGG
GATCTCTAAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAATTTCTCCATCGGTCCCATGA
TGCTTGCCCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACACCTCCTATCAGTTGTCAGCTCCCAGTGATCCC
CTGGACATCGTGGTCACAGGTGAGAGTGTCTAGACATTGTTCTCATTGTCACTGGGACACAGAGTGAATGATCCAGGACT
TGGAACCCCCAGGTGGTCATGAGGAAGATAAGTGTGGGATTCTTACGGAAAGAGAGTGACTTGGTGAGGTCTGTACCAAC
AGAGACAGAGAAACAGGAGACATAAGTACAGAACAGTTGTCATAACAGAGGACAGACACAGGGGCCATACAGGGAGGTAG
AAAAGAGAGAAAGAGGTAAAGGAGACACTCAGACAGACAGACATGTCCCAGAGAGAGGTGTCCTTCCATGCTGACTTTGC
TCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTGTTCCTACCAGAAGAACCCAAGGACAC
CCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGCCACCTACAGATGCCGTGTTTATTCTGACACCTCT
GCCTTCCATGCAATGGAGAGTAATCATCCCAGGATATCATGGCCCCTGAACACCAACCCCTGTATGCTGTGTGAACTTGG
GGTCCCCAGACTGGATTCTGAGGCTCATATTCCAAATAATCCCACATATGATAGGATCGCTGAGAGACACAGAGAAAAAT
CAGGGACACCAAAAAGCAAAGACATAAACACACACAAAATGAGCCAGAAGAAGGAGATTAAGAGATTCACAGACACATAA
AAAGAAAGAAAAGAGGGCAGAGTGGAGAGAATGATGGAAAGGAGGAGAGAAAAGCCCCAAAATCAGAACCCTGAGGGAGG
GACACAAAGACAGAGAAAGATAAATATGTGGGGATGGATTGCAGAGATTCCAAATAGAACTAGAGAGACTGAGAGGCAGA
GAAAGACAAGGAGACGGAGAGAGAGAGATGATAGATGGATAGATAGACGTAGATAGATGATAAATAGGTAGATGATAGAT
AATGGATTGGTTATAGATACATAGATGATGACTGATAGATGATACATAGAGATGACGATGATGATGATAGACACATAGAT
ATATACATAGATGATACATAAATAGAGACAGAGAGGCAGACAGAGAGGTAATAGAGAGAGAGATAGATGATACATATATA
GATAATAGATGATTGATGGATAGATAGACAGACAGACAATTGATAGAGAGATAGATAAGTGATACATAAATATAGATGAT
AGATAATTTGTAGATAGACACAAAATAGATTAATAGATAGAAATGTGCAGAAAGTTATGAACAAGACAGAAAGTGAGAGA
CTCAAAATTAAAGAAAAAGGAAGATCAAGTCAACCAATCCAAGGAGGGTCAGAGAGAATAAAACAATCCAAAAAGGGAAA
ACATACCTCAGGGTGGGGAATTGAGGTCATAGACCTAGAGAGACAGAAAAGGTAGAAGGAGGAAACAGATATGAAGAGAG
ATGGGGTGGAGGGTGAGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTATGAGGGG
AGCTATGACAAGGAAGAACCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCCATATGAGAAACCTTCTCTCTCAGCC
CAGCCGGGCCCCAAGGTTCAGGCAGGAGAGAGCGTGACCTTGTCCTGTAGCTCCCGGAGCTCCTATGACATGTACCATCT
ATCCAGGGAGGGGGGAGCCCATGAACGTAGGCTCCCTGCAGTGCGCAAGGTCAACAGAACATTCCAGGCAGATTTCCCTC
TGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTTGGCTCTTTCCGTCACTCTCCCTACGAGTTGTCAGACCCGAGT
GACCCACTGCTTGTTTCTGTCACAGGTGAGAAAAGCCCATATCTCTCTCATGTCCTATGATCCTAAATCCTTAGCTAAGG
AGCTTCCTGCTGATGATGGAGAAAAGCATGGACAGATGCAGAGAGAAGACACAGCAGGTGTGAGGGCGGAGTCAGGGCGC
AGGATGGCAGACAGGGCACCTCCAAACCCTCCTTCATGGCCTGCATGGAGGCCTCCGATCAGGGCTCCAGGCACCCAGGC
AGATGGAGAAAGCGGTCAGGACAGACCCAGAGAAGGGGAGACTGGGCTTAGTTTCGGGAGATCAGAGGTTCCCTCAGCCC
CTCAATCTTATCCATTTCCCAGAAGCCCATCATGGCCTCTCACCCACACAGAGAGATGTCATCACCAGCAACCCCTACAC
CCTTTTCTTTTCATTTTCAAAAATATTTATTGAGGTTAAATGTAACTATATAATTTACCACCTTTACCATTTTTAAAAGT
AAAATCTAGTGGTCATAAATACCTTTATATGCTGGGTGTGGTGGTTCACGGTTGTAATCTCGGCGCTTTGAGAGGCCAAG
GAAGGTGGATCATTTAAGATCAGGAACTCGAGATCACCCTGGCCAACATGTGGGAAATTCATCTTTACTAAACAGACAAG
AAAAATTAGCCGAGCATGCCGGCATGCACCTGTAGTCCTAGCTACTTGGGAGGCTGAGGCAGGAGAAGCACTTAAAGCCA
GGAGGCAGAGGTTGCACTGAGCCGAGATCATGCCACTGCACTGCAGCCTGGGAGACAGAGAGAGACTCTGTTTCTAAATA
AATAAATACATCTATATTCTTTTTTTTGTTACCCTCCACCCTTCCCTTCCTGGCCTCTGGTGTCCACCATTGTATTCTCC
ACCTTCATGAGATCCACCTTTTATCTCCTGCATGTGGTGAGAAATGGGAATCTTTGTAATGACCTCCAGTTCCATCCATG
TGGCTGCAAATGACAGGATGTTATTGTTTCTATGGATGAGTAGTCTCCACCGTGTGTGTGTACTACAGTTCTCTATCCAT
TCACCCACTGATAGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGGAACAGTCATATGAGTGCAGAT
ATCACTTCGATACACTGATGTCCTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGACACTATGAAAGTTCTCTTT
TTTTTTTTTCCTTTTTTGAGAAAGAGTTTCCCTCCTTAGTCCAAGCTGGAGTCTAAGTGGTGAGATCTTGGCTCATTGCA
ACCTGTGCCTCCTAGGTTCAAATGATTGTCCTGACTCAGCCTCCCTAGTAGCTGTGATTACAGGTGCACGCCACCATGCC
TGGCTAATTTTTGTACTTTTTTAGCACAGACGGGATATCCCAATTTTGGGCAGGCTGCTCTCAAACTCCTGACCTCAAGT
GAGGTGCCTGCCTCGGTTTCCCAAAGTGCTGAAGTTACAGGCATAAGCCACTATGCCCAGCCTCCTTTTAGTTTTTTAAA
GAATTTCCATACTTTTCTCCATAATAGTTGTACTAATTTACATTCCTACCAACAGGGTACCAGGGTTCTCCTTTCTCTAC
CATCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGTAAAAGCCATTTTACTTTACTTTATTTTATTTATTTATTTATGTTG
AGATGGAGTTTCACTCATAGTCGCCCAGGCTGGAGTGCAAGGGTGTGATCTCAGCTCACTGCAACCTCCGCCTCCCGCGT
TCAACTGATTCTCCTGCCTCAGCCTCCAAAGTAGCTGGGATTACAGGCATGTGCCACCACGCCTAGCTAATTTTTGTATG
TTTAGTAGAGAGGGAGTTTCTCCATGTTGGTCAGGCTGGTCTCCCGACCTCAGGTGATCCGCCCACCTCCGCCTCCTGAA
GTGCCGGAATTACAGGCGTGAGCCACCGGCCTAAAAGGCATTTTAATGGGATGAGATGAAAACTCATCGCGATTGTAATT
TACATTTCTCTGATGATGAGTGATGCCGAGTACTTTTTCATATACGTGATCGCCATTTCTATGTTTTGTTTGTGGAGAAA
TGTCTCCTCATGACTTTTGCTCTTTTTTTGAATTAAATTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCCAGTTATT
AATCCCGTCTCAGATGAATAGTTTGCAAATATTTGCTCCTATTTTGTCGGTTGTCTCTTCACTTTCTTGGTTTATCTTTT
GTGGTGCAGAAGTTGCTTGGTTTGATGTAATCCTAATGGTCTATTTTTTGCTTTGATTACTTGTGTTTTGAAGGTTTTAA
ACAAAATGTCTTTCGTCAGACAAATGTCTTCCCCATTATTTTCTTCTACATGTTTCATAGGTTCAGGCCTTAGACTCATG
TTTTTAATCCATTTTCATTTGATTTTTGTGTAAGGTGACAGGTATAGATGCAGTTTTATTCCTCTGCATGTAGATATCCA
GTTTTCCCCACACCATTTATTGAAAAGACTGTCCTTTCCTGATTGTAAGTTCTCGGCACCTTTGTCAAAGTCCATTAAAT
GGGCTGGGTATGGTGGCTCACACCTGCAATTCCAGCACTTTGGGAGGCCGAGGCGGATGGATCACCTGAAGCCAGGAGTT
CAAGACCAGGCTGGCCAACAGAGTGAAACCTCGTCTCTACTAAAAATACAAAAATTAGCTGAGCATGGTGACCAGTGCCT
GTAATACCACTACTCGGGTGTTTGAGGCAAGAGAATTGCTTGAATCCAGGAAGTGGAGGTTGCATTGAGCTGAGATTGCA
CCTCTGCACTCCAGCCTGCATGACAGAGCAAGATTCTATCACACACACACACAAAAAAAGCCATTGGATGTAAATGCATG
GATTATATCTGTGTTCTCCATTCTGTTCCATTTTTTATGTGCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTACTAC
AGCTCTGTAACATATTTCTAAGTCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTCAAGTCTCAAGACAGTGGGC
ATCGCACACAAAAATTATGGAGAAGAGGATCCCAAGACTCCCAGGGTCCAACATTAGATAACAGAGTGTTGGCCATGAAC
CAACCTCAAAGATTTCCATTGAGTAGAGGACAAGCACCCTCATTTCCTCACATCTCTCCTGTCCCGTGTTCTAGGAAACC
CTTCAAGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTGAGTAAAGGACCCCTCTTATCTCTGCTTTTGGA
AACCTGGGGAGGTGGAAGCCTTGGATGCAAGTGTTGGCTCAAACCTCCCAGCTCTGTGAATGAGGGCCTGTCTTCCACCA
TCTCTGAACTCCAGACACTCCAACAGTGAAAGGGATCTAGGGCCACCAAAGGGCTCAGCGAAGTCTCTTAACCTTTAATA
TCCTGCAGGTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAACATGCAGTGTTTTTT
CTTCCTGCATTCCTAACTGGAGGATAAATTCCTGGGGACTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGCGAGG
TGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAATTACTGTTGGTCATGAAGCAACCCTGGCTGACTCAGCAGAGCAAGA
GCCTTGCCGTAATAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCAGCCACAGCCCCATGCTCAGG
CTGTGCAGTTGGAATCCTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAGCGGCTTTTTA
ATTATCTTACAGTGCTGTAGCTCAAAGTATGAAGTGCATCTCACTGGGCTAAAAACAAGGTGACAGCAAGGCTGCCTTCC
CTTGCCTGAGGATTCCAGGCAAGAATCTGCTTCTCACTTGTCCCATCTTATAAAGGCTCCCAGTTCCTTGGCTCCTGGTC
CCCTTCCTCCTTCCTCAAAGCCCACAAAGGCTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACC
TCTTTCTCTGAATGCTGCTCTCCCTTCTTCCTTATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAAT
CCATCATAATCTCCCGGAAATCATTCAGGATACCCTTGTTTTAAGTTCAGCTGACTAGCAACCGTAATTCCATCTGCAAT
CTTCATTCCTTCTTTCCATGTAAAATAACATATTCACAAGCTATGGAGGCCAGGACAGGGACATTTTGGGGTGGGACAGC
ATTCTCCTGCCTTCCACGAACGGTGAACAAGATGCATTTGGCCTCTGCTCTTGGGACACTGATATTGCAGATGGTTAAAT
GGGAGGGCAGAAAATGAATGCACAAGTGGACCAATAAATGAATGATCCATTGGGAAGCATCTGTGTATGAAATCTATTTG
TTTGTTCGTTCATTTATTTATTGAGACAGAGTCTCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCAC
TGCAACCTGCGTCTCCTGGATCCAAGTGATTCTCCTGCCTCCGCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCA
TGCCCGGCTAATTCTTTTTGTATATTTTTTGTAGAGAGGATGTTTCACCATATTGGCCAAGCTTGTCTGAAACTCCCAAC
CTCAAGTGATCCGACCATCTCAGCAACCCAAAGTACTGGGATTACAGGCGTGAGCCACTTTGCCCAGCCAGAATTCAAAA
TAAATAATAGATAATGCTGAGTGTATAATTTTGGGTGACAGAGAAGGTCTCACTAATCAGATATTTGTGACATTAATGAA
AAACACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTTTCCACACAGCTGTCAGCTGTGAAGGCACAAAGGTGAAAAC
AATCTGATGTTGAAGGAAGAGGCTCTGACTCAAATGCTGGGAATGAAGTGGGGAGAATGACAAGACGACTGTGGAGAGAC
GGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCCTTGGATTCACCTC
GGGGTAACCAGGAATCCCTACATGATTAATAGTGACTGACATGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCTAG
GAGACCGTGGAAAAGGCAATTCCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACCCTAAGTGGATGAAGCAGATGGA
TATAAGCTATGCTTGGGAGGTAGAATCATTTGCAGGGAGGGCTTGCTGGGTTTGAGTTTCCTAGTTGTTTAATCCTTGCT
AAATTAATTTCTTTCTGAGATTTATTCCTCCTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGGTG
GTGGAAATGAAGGGACCTATTATAGCATAGTATACAAGTCTGTGAACGGTGGCTCACTCCTGTAACCCAGCACTGCAGGA
GGCTAAGGCCAGTGGATTCCAAGAAGTCAGGAGTTCGAGACCAGCCTGGCCAACATGGTGAAACCCTATCTCTACATGGT
GAAACCCTATCTCTCCTAAAAATACAAAAATTAGCCGAGCATGGTGGTGCATCCCTGTAATCCCAGCTCCTGCTCTGGAG
GATGAAGCAGGAGAATGACTTCAACCCAGGAGATGGAGGTTGCAGTGAGTGGAGATCGCATCACTGCACTCCAGCCTGGG
TGACACAAGGAGACTCCATCTCAAAAAATAAAAATAAGAAATGCATAAATATAATAAAACACACACGAATGACAAAGGCA
CCTGAATTCCCATCATCATTTTTCTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATCAGCCT
AAAACCTCTTCCGTATTTGGCTTTCTGTGAGCATGAGATCATATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCACAA
ATCCTGGAATAGAGAAAGTGCTCTCGTCATCACAAAAAAAACTTGCCCCCTCACCCAAATCCCCCATCTCACCCCTACTT
CCAATCACCTGTGGAGATACAGATAGATCATGGGGAGGTAAATGCTAATACTCCTTGGAGTGAGTCCAGATCTTGGAATC
AGAGATCAGCGACAGCACTAGCTCCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTATTGAAGCAATAGATA
GTCGAGGGGGTGGTCCTTCCCCCAGCCTCTCAGGTAGAACAGCAGCCTAACATGTGTCTCCCGAGATCACAAAGAGTAGC
ACATTTCACACGGGCTTCAACACTATTTTCTGGCTGTTTGACATAAGAGAATTCTACTTCGCTTTTTTTATATTGATTTC
ACTTTTGTTTCCTTTTCTTGGAGAATGCAAGTTGTTTAACTCAAGAATGCCGTGGATGTAGAAATCCTAAAGCACATTCG
CTGTGTATCAATCCCAGTCCAGTCTTCCCAGAGAAGACTCTAAACACCTCCTGGACTGCACCTGGGCCTATGCCAATTCC
TATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCA
GCGAGTGACAACAGAAGCCTACATTTCAATGTGAGCCAGTTCCCCAAGGCTCAGAAAAGCTGCTCGAGACATGTGGAGTC
ACCCCATTTGCAGTGTAGCTGGGGGAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTC
AGCTAAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGGGACGATCCTCCTGATCT
CAGGACTTTGCTGTCTTAGTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGGGTAACTTCTAAAGAAGAGATTGGT
TTGCCTCACCATTCTGCAGGCTGTACTGGAAGCATGGCACCAGCATCTATTTCTTATGATGGCCTCAGGCCGCTCCCACT
CTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCACAGAGATCACACGGCAAGAGAGGGAGCAAGGGGGAGGGGGA
GCAATGGAGCTTCCAAGCTCTTTTTAACAACCAGCTCTCCAGGAACTAATAGAGAGGGAACTTGCTAACCCCGTCTCCTT
GGGACAGCATTGATCTGTTCATGATGGATCCACCTCCATGACCCAAACACCTCCCAAGAGGCCCAACCTCCCACACTGGG
GGTTAAATTTCAATGTGAGGTTTGAAGGGGTCAAACATCTCAACTAAAGTAGTTGTATCCTCAGCACGTTCCATGGTTAC
TATGAGAGCTATAACTGAGAAAGCAGGAGGAAGCTAGGTCTCCCGCCATCTGGGTGCTTGTCCGAAAGAGATGCTGTAAG
TGGTTACCTGTCAATCAAGAAATGCAAGACAATTCATATAGAGAAACTGCTATGATTAGCTTCTTACTGGTGTCTCCTCT
TCTTCCAGGTAACCCCAGACACCTGCACATTCTGATTGGGACCTCAGTGGTCATCATCCTCTTCATCCTCCTCCTCTTCT
TTCTCCTTCATCTCTGGTGCTCCAACAAAAAAAGTAAGTCTCACGCGGCACAGGCCAGAGAGCTCAGGGCCATGTGGGGA
AGCAGGATGGGAGCACACAGCTGTGTGTTCCTCACTGGCAGGATGGTCCCTGGCCCAAGACAGGAGCCACAGAGGCAGGA
CTTTCTAGAGAGAGCACCAGACTCCCTGCCCCTGCCTTCAGCTCACAGACCGTTGCCTGATTCTGAACTGTATCCTCATG
TCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGAGACAGAATCAATGGGATGGGAACTC
AGAGCTATTCATGGGATGGGTCCTTGAGCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGG
CACCTATGGCCTCCCCCTGTTTGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTCTTTTGTTGAC
TTCCGTCTCCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGCCAACAGCGAGGTAGGTGCTCCT
CGGCCCAGCCTCATGGCTAGTGTTATTCCCAAACAGTCCTGGAAAACGTGAGCACCCTCCCTCACTCAGCATTTCCCTCC
CTCACTCAGCATTTCCCTCTCTCCAGGACTCTGATGAACAAGACCCTGAGGAGGTGACATACGCACAGTTGGATCACTGC
GTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGACACCCCCTACAGATACCATCTTGTACACGGAACT
TCCAAATGCTAAGCCCAGATCCAAAGTTGTCTCCTGCCCATGAGCACCACAGTCAGGCCTTGAGGGCGTCTTCTAGGGAG
ACAACAGCCCTGTCTCAAAACCGAGTTGCCAGCTCCCATGTACCAGCAGCTGGAATCTGAAGGCGTGAGTCTTCATCTTA
GGGCATCGCTCCTCCTCACGCCACAAATCTGGTGCCTCTCTCTTGCTTACAAATGTCTAGGTCCCCACTGCCTGCTGGAA
AGAAAACACACTCCTTTGCTTAGCCCACAGTTCTCCATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTAC
TTCCTAGTCTACTTGAGGCTGCGATCACACTGAGGAACTCACAATTCCAAACATACAAGAGGCTCCCTCTTGACGTGGCA
CTTACCCACGTGCTGTTCCACCTTCCCTCATGCTGTTTCACCTTTCTTCGGACTATTTTCCAGCCTTCTGTCAGCAGTGA
AACTTATAAAATTTTTTGTGATTTCAATGTAGCTGTCTCCTCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR