Allele Report for 3DL1*0010102


3DL1*0010102
Previous Designations & Local Names: FH06_BA1
IPD Acc No: KIR00434
Assigned: 28-AUG-2009 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182341  
Cells Sequence Derived From: FH06  
Known Ethnic Origin Of Source: Hispanic
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (386 aa)
MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESF
NMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGI
SKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESV
TLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPS
SSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSE
Nucleotide Sequence Data (1158 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTGTTCTTGGTCCAGAGGGCCGGTCCACACATGGGTGGTCAGGA
CAAACCCTTCCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACACGTGACTCTTCGGTGTCACTATCGTCATA
GGTTTAACAATTTCATGCTATACAAAGAAGACAGAATCCACATTCCCATCTTCCATGGCAGAATATTCCAGGAGAGCTTC
AACATGAGCCCTGTGACCACAGCACATGCAGGGAACTACACATGTCGGGGTTCACACCCACACTCCCCCACTGGGTGGTC
GGCACCCAGCAACCCCGTGGTGATCATGGTCACAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGG
TGAAATCAGGAGAGAGAGTCATCCTGCAATGTTGGTCAGATATCATGTTTGAGCACTTCTTTCTGCACAAAGAGGGGATC
TCTAAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAATTTCTCCATCGGTCCCATGATGCT
TGCCCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACACCCCCTATCAGTTGTCAGCTCCCAGTGATCCCCTGG
ACATCGTGGTCACAGGTCCATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCAAGGTTCAGGCAGGAGAGAGCGTG
ACCTTGTCCTGTAGCTCCCGGAGCTCCTATGACATGTACCATCTATCCAGGGAGGGGGGAGCCCATGAACGTAGGCTCCC
TGCAGTGCGCAAGGTCAACAGAACATTCCAGGCAGATTTCCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TCGGCTCTTTCCGTCACTCTCCCTACGAGTGGTCAGACCCGAGTGACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCA
AGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTAACCCCAGACACCTGCACATTCTGATTGGGACCTCAGT
GGTCATCATCCTCTTCATCCTCCTCCTCTTCTTTCTCCTTCATCTCTGGTGCTCCAACAAAAAAAATGCTGCTGTAATGG
ACCAAGAGCCTGCAGGGAACAGAACAGCCAACAGCGAG
Genomic Sequence Data (14369 bps)
GTTCGGGAGGTTGGATCTGAGACGTGTTTTGAGTTGGTCATAGTGAAGGACGCGAGGTGTCAATTCTAGTGAGAGCAATT
TCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCCT
CCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCG
CAGCCGCCTGTCTGCACCGGCAGCACCATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAAT
CGAGGGAGGGAGTGCGGGGATGGAGATCTGGACCTGGAGGTAAAGATATGGGCCTAGAGGTGGAGTTATGGGCCTAGAGG
TGGAGTTATGGGCCTGAAGTGGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATAGGGGCCTGGGGTGGA
GATATGTGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATATGTGCCTGGGGTGGAGAGA
TGGGCCTGGAGGGGAGATATGGGCCTGGAGGGGAGATGTGGGCCTAGAGGTGGAGTGATGGGCCTAGAAGTGGAGCGATG
GGCCTGGAGTGGAGATATGGGCCTGGAGGTGGAGTTATGGGCCTGCAGTAGAGATATGGGCCTGAAGTGGAGATATGGGC
CTGGAGTGGAGATATGGGCCTAGAGGTGGAGTTATGGGCCCGGAGGTGGAGTTAAGGGCATGAAGTGGAGATCTGGGCCT
GGAGTGGAGATATGATCCTGGAGTGGAGATATGGGCCTGGGGTGGAGATACGGGCCTGGAGCAGACATACAAGCCTGGAA
AGGAGATATGGGCCTGGAGAGGAGATAGAAGCCTGGAGTGGAAATATGGGCCTGGAGTGGAGATATGAGCCTGGAGTGGA
TATATGAGCCTGGAGTTGAGATAGGAGCCTGGAGTGGAGATATGGGCCTGGAGTGGACTTACCAGCCTGGAGAGGAGATA
TGGGCCTGGAGTGGAGATACGGACCTGGAGTGGAGATCTGGGCCTGTTGTGTAGATCTAGGCCTGGAGGTAGAGATCTGG
GCCTGGAGGCTCAGTCTCTGCACAGCCGAGATCCTTGTTCCTGGGGGCAGGTAGGCAGCGAGGGTGAGTTTACCTTCAGC
CCAGCAAGGGCCTGGCTGCCAAGACGCACAGCCCAGTGGGGGCAGCAGGGTGCCCTGGTTTGCCTGCAGAGGGATGGTCC
ATCATGATCTTTCTTTCTAGGGTTGTTCTTGGTCCAGAGGGCCGGTCCACACATGGGTGAGTCCTTCCCCAAACCTTAGG
GTGTCATCTCCCCACATAAGAGGATTTTCCTGAAATGGGAGGGAAGTCCTGTCGGGGAGTCTCTCATACACTAGGAAGAG
GGGACCCTCGGATGCTCGGCCCACATTTCTGACCTTGCCTTCCCCGGCCTTTCATTCCCTTTCCTGAGTCAAGCTCTGTG
AAGACTGGGGTGAGACTAGGGTGCTCCAAGATGGGTGTGCAGGGAGGAAGTGGTGTCAGCAGCAGAGAAAGAGAGGGAAG
CAGTGCTAGGAACAGCAGGTCCTCTGAGGACAAAGGTGTAACTCACACCCTCCAGCGTTTCCGTGATGGTAGGGGCTGCA
GTGTGGCTGCGGTCTTTCTACCAGAAAAGGTGAGGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGATGGGGGC
TCAGTTCATCAATTGGCTGATATTCCATTCACATAGGACTTGCCCTCCATGCCGTGTCTACTTTGTGTTGTTTTATATGA
GTAATTTTGCAGTATTAAAATCTAGTAAGAGTTGCTTCTCCAGCAACTTGCTCAAAGTTCTCAGCTGACACTTGTTGTAG
GGAGACGCCAAGTCTATGCAGGATGGGTCCTTCCTGTAGCCCTGGGCACCCAGGTGTGGTAGGAGCCTTAGAAAGTGGAA
ATGGGGAGAATCTTCTGGGCACTGGGAGTGAGGGGCGGCTCCACATCCTCCTCTCTAAGGCAGTGCCTCCTTCTCCCCCA
GGTGGTCAGGACAAACCCTTCCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACACGTGACTCTTCGGTGTCA
CTATCGTCATAGGTTTAACAATTTCATGCTATACAAAGAAGACAGAATCCACATTCCCATCTTCCATGGCAGAATATTCC
AGGAGAGCTTCAACATGAGCCCTGTGACCACAGCACATGCAGGGAACTACACATGTCGGGGTTCACACCCACACTCCCCC
ACTGGGTGGTCGGCACCCAGCAACCCCGTGGTGATCATGGTCACAGGTCAGAGGCTTTCCGTCTGGGCTTCTCACTGTCC
CACCTCCTGAATCCCAGAGCTTCTGGTGGGGGTGTCCGTCAGGGTCCCATCACCCAGGCCCTGACTGTATTTGGGGTCAA
GGGAGATTGAATACAGGGGAAATGGGTGCTGTGGTGGGAAGAATCACTGTCCCCAATGATGGCTACATTGTAATCCCTGG
AGCCTGTGACTATTTATGTTACAGGGCAGGGGACTGAAGGGGAAGGTGGAGCTCAGGTTGTTGATGAGTTGACCTTGAGA
TGGGGAGACAGCCTGGACTGTCCCACTGGGCTCAGTGTAATCACAAGGGTCCACATGAGAGGTGGAGGAAGAGGGGAGTG
GGGATTAGAGCAGTGTAGTGGGAGGGAGACGCTATCAGCCACTGCGGGCTTTGAAGGTGGAGGAAGACCACTAGTCACAG
AATGCAGGTGGCCTCTAAGGGCTGGAGAAGTCAAGAGAACTGATTCGCTGATTCTCCAGAGGGAACGCAGCCCTGTAGAC
ACCTTGATTTCAGCACAGGGAGAACTGGATCCAATTTCTGTCTCCAGAAGTGGAAGGGGTCAGTGTGTTCTCTCCCGCTG
CCATGTTTGTGGTAATTTTCTGCAGCAGCAACAGGAAACCAACACAGGAACCCAGGTCAAGGACAAGTTAGGAAACCAAA
CAAGGATAGCCAGATGTGGTGGTGGGCACGAGTAATCCAACGACTGGGGAGGCTGAGGCAAGAGAATCACTTGAACTGGG
GATTTGTTCAAAAGAGATTGATTCAGGCTGCTAAGAGCCTGGACATGCAGCCTGTCCTCTTCCACCCCCACATAGACAGC
AGGAAAGAGATTAGTGGGAAACAGATACAACAGCCCAAGAGATGAGGCTGTCTTCACAGTGGCAAGGGAGTCAGGGGCTA
CTGGAGACAGAGGGACAGAGAAGAGGGAGGAAGACAGATGGAGGCACCTGCACCAGGGGATATGGGCACAGAAAAGACAC
GGAGATGCAGAGAGGGAGGAGAGAGACAGACACGGGGAGGGGAACCCTCACTCATTCCAGGTGCCATGGATGGGATGATA
AAGAGAGATGCCTTCTAAACTCACAACTTCTCTTTCTAGGAAACCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCC
CTGGTGAAATCAGGAGAGAGAGTCATCCTGCAATGTTGGTCAGATATCATGTTTGAGCACTTCTTTCTGCACAAAGAGGG
GATCTCTAAGGACCCCTCACGCCTCGTTGGACAGATCCATGATGGGGTCTCCAAGGCCAATTTCTCCATCGGTCCCATGA
TGCTTGCCCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACACCCCCTATCAGTTGTCAGCTCCCAGTGATCCC
CTGGACATCGTGGTCACAGGTGAGAGTGTCTAGACATTGTTCTCATTGTCACTGGGACACAGAGTGAATGATCCAGGACT
TGGAACCCCCAGGTGGTCATGAGGAAGATAAGTGTGGGATTCTTATGGAAAGAGAGTGACTTGGTGAGGTCTGTACCAAC
AGAGACAGAGAAACAGGAGACATAAGTACAGAACAGGTGTCATAACAGAGGACAGACACAGGGGCCATACAGGGAGGTAG
AAAAGAGAGAAAGAGGTAAAGGAGACACTCAGACAGACAGACATGTCCCAGAGAGAGGTGTCCTTCCATGCTGACTTTGC
TCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTGTTCCTACCAGAAGAACCCAAGGACAC
CCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGCCACCTACAGATGCCGTGTTTATTCTGACACCTCT
GCCTTCCATGCAATGGAGAGTAATCATCCCAGGATATCATGGCCCCTGAACACCAACCCCTGTATGCTGTGTGAACTTGG
GGTCCCCAGACTGGATTCTGAGGCTCATATTCCAAATAATCCCACATATGATAGGATCGCTGAGAGACACAGAGAAAAAT
CAGGGACACCAAAAAGCAAAGACATAAACACACACAAAATGAGCCAGAAGAAGGAGATTAAGAGATTCACAGACACATAA
AAAGAAAGAAAAGAGGGCAGAATGGAGAGAATGATGGAAAGGAGGAGAGAAAAGCCCCAAAATCAGAACCCTGAGGGAGG
GACACAAAGACAGAGAAAGATAAATATGTGGGGATGGATTGCAGAGATTCCAAATAGAACTAGAGAGACTGAGAGGCAGA
GAAAGACAAGGAGACGGAGAGAGAGAGATGATAGATGGATAGATAGACGTAGATAGATGATAAATAGGTAGATGATAGAT
AATGGATTGGTTATAGATACATAGATGATGACTGATAGATGATACATAGAGATGACGATGATGATGATAGACACATAGAT
ATATACATAGATGATACATAAATAGAGACAGAGAGGCAGACAGAGAGGTAATAGAGAGAGAGATAGATGATACATATATA
GATAATAGATGATTGATGGATAGATAGACAGACAGACAATTGATAGAGAGATAGATAAGTGATACATAAATATAGATGAT
AGATAATTTGTAGATAGACACAAAATAGATAAATAGATAGAAATGTGCAGAAAGTTATGAACAAGACAGAAAGTGAGAGA
CTCAAAATTAAAGAAAAAGGAAGATCAAGTCAACCAATCCAAGGAGGGTCAGAGAGAATAAAACAATCCAAAAAGGGAAA
ACATACCTCAGGGTGGGGAAGTGAGGTCATAGACCTAGAGAGACAGAAAAGGTAGAAGGAGGAAACAGATATGAAGAGAG
ATGGGGTGGAGGGTGAGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTATGAGGGG
AGCTATGACAAGGAAGAACCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCCATATGAGAAACCTTCTCTCTCAGCC
CAGCCGGGCCCCAAGGTTCAGGCAGGAGAGAGCGTGACCTTGTCCTGTAGCTCCCGGAGCTCCTATGACATGTACCATCT
ATCCAGGGAGGGGGGAGCCCATGAACGTAGGCTCCCTGCAGTGCGCAAGGTCAACAGAACATTCCAGGCAGATTTCCCTC
TGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTCACTCTCCCTACGAGTGGTCAGACCCGAGT
GACCCACTGCTTGTTTCTGTCACAGGTGAGAAAAGCCCATATCTCTCTCATGTCCTATGATCCTAAATCCTTAGCTAAGG
AGCTTCCTGCTGATGATGGAGAAAAGCATGGACAGATGCAGAGAGAAGACACAGCAGGTGTGAGGGCGGAGTCAGGGCGC
AGGATGGCAGACAGGGCACCTCCAAACCCTCCTTCATGGCCTGCATGGAGGCCTCCGATCAGGGCTCCAGGCACCCAGGC
AGATGGAGAAAGCGGTCAGGACAGACCCAGAGAAGGGGAGACTGGGCTTAGTTTGGGGAGATCAGAGGTTCCCTCAGCCC
CTCAATCTTATCCATTTCCCAGAAGCCCATCATGGCCTCTCACCCACACAGAGAGATATCATCACCAGCAACCCCTACAC
CCTTTTCTTTTCATTTTCAAAAATATTTATTGAGGTTAAATGTAACTATATAATTTACCACCTTTACCATTTTTAAAAGT
AAAATCTAGTGGTCATAAATACCTTTATATGCTGGGTGTGGTGGTTCACGGTTGTAATCTCGGCGCTTTGAGAGGCCAAG
GAAGGTGGATCATTTAAGATCAGGAACTCGAGATCACCCTGGCCAACATGTGGGAAATTCATCTTTACTAAACAGACAAG
AAAAATTAGCCGAGCATGCTGGCATGCACCTGTAGTCCTAGCTACTTGGGAGGCTGAGGCAGGAGAAGCACTTAAACCCA
GGAGGCAGAGGTTGCACTGAGCCGAGATCATGCCACTGCACTGCAGCCTGGGAGACAGAGAGAGACTCTGTTTCTAAATA
AATAAATACATCTATATTCTTTTTTTTGTTACCCTCCACCCTTCCCTTCCTGGCCTCTGGTGTCCACCATTGTATTCTCC
ACCTTCATGAGATCCACCTTTTATCTCCTGCATGTGGGTGAGAAATGGGAATCTTTGTAATGACCTCCAGTTCCATCCAT
GTGGCTGCAAATGACAGGATGTTATTGTTTCTATGGATGAGTAGTCTCCACTGTGTGTGTGTACCACAGTTCTCTATCCA
TTCACCCACTGATGGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGGAACAGTCATATGAGTGCAGA
TATCACTTCGATACACTGATGTCCTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGACACTATGAAAGTTCTCTT
TTTTTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGTCCAAGCTGGAGTCTAAGTGGTGAGATCTTGGCTCATTGC
AACCTGTGCCTCCTAGGTTCAAATGATTGTCCTGACTCAGCCTCCCTAGTAGCTGTGATTACAGGTGCACGCCACCATGC
CTGGCTAATTTTTGTATTTTTTTAGCACAGACGGGATATCCCAATTTTGGGCAGGCTGCTCTCAAACTCCTGACCTCAAG
TGAGGTGCCTGCCTCGGTTTCCCAAAGTGCTGAAGTTACAGGCATAAGCCACTATGCCCAGCCTCCTTTTAGTTTTTTAA
AGAATTTCCATACTTTTCTCCATAATAGTTGTACTAATTTACATTCCTACCAACAGGGTACCAGGGTTCTCCTTTCTCTA
CCATCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGTAAAAGCCATTTTACTTTACTTTATTTTATTTATTTATTTATGTT
GAGATGGAGTTTCACTCATAGTCTCCCAGGCTGGAGTGCAAGGGTGTGATCTCAGCTCACTGCAACCTCCGCCTCCCGCG
TTCAACTGATTCTCCTGCCTCAGCCTCCAAAGTAGCTGGGATTACAGGCATGTGCCACCACGCCTAGCTAATTTTTGTAT
GTTTAGTAGAGAGGGAGTTTCTCCATGATGGTCAGGCTGGTCTCCCGACCTCAGGTGATCCGCCCACCTCCGCCTCCTGA
AGTGCCGGAATTACAGGCGTGAGCCACCGGCCTAAAAGGCATTTTAATGGGATGAGATGAAAACTCATCGCGATTGTAAT
TTACATTTCTCTGATGATGAGTGATGCCGAGTACTTTTTCATATACGTGATCGCCATTTCTATGTTTTGTTTGTGGAGAA
ATGTCTCCTCATGTCTTTTGCTCGTTTTTTAATTAAATTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCCAGTTATT
AATCCCGTCTCAGATGAATAGTTTGCAAATATTTGCTCCTATTTTGTCGGTTGTCTCTTCACTTTCTTGGTTTATCTTTT
GTGGTGCAGAAGTTGCTTGGTTTGATGTAATCCTAATGGTCTATTTTTTGCTTTGATTACTTGTGTTTTGAAGGTTTTAA
ACAAAATGTCTTTCGTCAGACAAATGTCTTCCCCATTATTTTCTTCTACATGTTTCATAGGTTCAGGCCTTAGACTCATG
TTTTTAATCCATTTTCATTTGATTTTTGTGTATGGTGACAGGTATAGATGCAGTTTTATTCCTCTGCATGTAGATATCCA
GTTTTCCCCACACCATTTATTGAAAAGACTGTCCTTTCCTGATTGTAAGTTCTCGGCACCTTTGTCAAAGTCCATTAAAT
GGGCTGGGTATGGTGGCTCACACCTGCAATTCCAGCACTTTGGGAGGCCGAGGCGGGTGGATCACCTGAAGCCAGGAGTT
CAAGACCAGGCTGGCCAACAGAGTGAAACCTCGTCTCTACTAAAAATACAAAAATTAGCTGAGCATGGTGACCAGTGCCT
GTAATACCACTACTCGGGTGTTTGAGGCAAGAGAATTGCTTGAATCCAGGAAGTGGAGGTTGCATTGAGCTGAGATTGCA
CCTCTGCACTCCAGCCTGCATGACAGAGCAAGATTCTATCACACACACACACAAAAAAAGCCATTGGATGTAAATGCATG
GATTATATCTGTGTTCTCCATTCTGTTTCATTTTTTATGTGCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTACTAC
AGCTCTGTAACATATTTCTAAGTCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTCAAGTCTCAAGACAGTGGGC
ATCGCACACAAAAATTATGGAGAAGAGGATCCCAAGACTCCCAGGGTCCAACATTAGATAACAGAGTGTTGGCCATGAAC
CAACCTCAAAGATTTCCATTGAGTAGAGGACAAGCACCCTCATTTCCTCACATCTCTCCTGTCCCATGTTCTAGGAAACC
CTTCAAGTAGTTGGCCTTCACCCACAGAACCAAGCTCCAAATCTGGTGAGTAAAGGACCCCTCTTATCTCTGCTTTTGGA
AACCTGGGGAGGTGGAAGCCTTGGATGCAAGTGTTGGCTCAAACCTCCCAGCTCTGTGAATGAGGGCCTGTCTTCCACCA
TCTCTGAACTCCAGACACTCCAACAGTGAAAGGGATCTAGGGCCACCAAAGGGCTCAGCGAAGTCTCTTAACCTTTAATG
TCCTGCAGGTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAACATGCAGTGTTTTTT
CTTCCTGCATTCCTAACTGGAGGATAAATTCCTGGGGACTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGCGAGG
TGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAATTACTGTTGGTCATGAAGCAACCCTGGCTGACTCAGCAGAGCAAGA
GCCTTGCCGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTCAGG
CTGTGCAGTTGGAATCCTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTTTTTA
ATTATCTTACAGTGCTGTAGCTCAAAGTAGGAAGTGCATCTTACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCTTCC
CTCTGAGGATTCCAGGCAAGAATCTGCTTCTCACTTGTCCCAGCTTCTAAAGGCTCCCAGTTCCTTGGCTCCTGGTCCCC
TTCCTCCTTCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACCTCT
TTCTCTGAATGCTGCTCTCCCTTCTTCCTTATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCA
TCATAATCTCCCGGAAATCATTCAGGATACCCTTGTTTTAAGTTCAGCTGACTAGCAACCGTAATTCCATCTGCAATCTT
CATTCCTTCTTTCCATGTAAAATAAGATATTCACAAGCTATGGAGGCCAGGACAGGGACATTTTGGGGTGGGACAGCATT
CTCCTGCCTTCCACGAACGGTGAACAAGATGCATTTGGCCTCTGCTCTTGGGACACTGATATTGCAGATGGTTAAATGGG
AGGACAGAAAATGAGTGCACAAGTGGACCAATAAATGAATGATCCATTGGGAAGCATCTGTGCATGAAATCTATTTGTTT
GTTCGTTCATTTATTTATTGAGACAGAGTCTCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCACTGC
AACCTGCGTCTCCTGGATCCAAGTGATTCTCCTGCCTCACCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCATGC
CCGGCTAATTCTTTTTGTATATTTTTTGTAGAGAGGATGTTTCACCATGTTGGCCAAGCTTGTCTGAAACTCCCAACCTC
AAGTGATCCGACCATCTCAGCAACCCAAAGTACTGGGATTACAGGCGTGAGCCACTTTGCCCAGCCAGAATTCAAAATAA
ATAATAGATAATGCTGAGTGTATAATTTTGGGTGACAGAGAAGGTCTCACTAATCAGATATTTGTGACATTAATGAAAAA
CACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTTTCCACACACAGCTGTCAGCCGTGAAGGCAGAAAGCTGAAAACA
ATCTGATGTGGAAGGAAGAGGCTCTGCCTGAAATGCTGGGAATGAGGTGGGGAGAATGACAAGACGACTGTGGAGAGACG
GAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACCTCG
GGGTAGCCAGGAATCCCTACATGATTAATAGTGACTGACATGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCTAGG
AGACAGTGGAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACCCTAAGTGGATGAAGCAGATGGAT
ATAAGCTATGTTTGGGAGGTAGAATCATTTGCAGGGAGGGCTTGCTGGGTTTGAGTTTCCTAGTTGTTTAATCCTTGCTA
AATTAATTTCTTTCTGAGATTTATTCCTCCTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGGTGG
TGGAAATGAAGGGACCTATTATAGCATAGTATACAAGTCTGTGAACGGTGGCTCACTCCTGTAACCCAGCACTGCAGGAG
GCTAAGGCCAGTGGATTCCAAGAAGTCAGGAGTTCGAGACCAGCCTGGCCAACATGGAGAAACCCTATCTCTACATGGTG
AAACCCTATCTCTCCTAAAAATACAAAAATTAGCCGAGCATGGTGGTGCATCCCTGTAATCCCAGCTCCTGCTCTGGAGG
ATGAAGCAGGAGAATGACTTCAACCCAGGAGGTGGAGGTTGCAGTGAGTGGAGATCGCATCACTGCACTCCAGCCTGGGT
GACACAAGGAGACTCCATCTCAAAAAATAAAAATAAGAAATGCATAAATATAATAAAACACACACGAATGACAAAGGCAC
CTGAATTCCCATCATCATTTTTCTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATCAGCCTA
AAACCTCTTCCGTATTTGGCTTTCTGTGAGCATGAGATCATATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCACAAA
TCCTGGAATAGAGAAAGTGCTCTGGTCATCACAAAAAAAACTTGCCCCCTCACCCAAATCCCCCATCTCACCCCTACTTC
CAATCACCTGTGGAAATACAGATAGATCATGGGGAGGTAAATGCTAATACTCCTTGGAGTGAGTCCAGATCTTGGAATCA
GAGATCAGTGCCAGCACTAGCTCCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTATTGAAGCAATAGATAG
TCGAGGGGGTGGTCCTTCCCCCAGCCTCTGAGGTAGAACAGCAGCCTAACATGTGTCTCCCGAGATCACAAAGAGTAGCA
CATTTCACACGGGCTTCAACACTATTTTCTGGCTGTTTGACATAAGAGAATTCTACTTCGCTTTTTTTATATTGATTTCA
CTTTTGTTTCCTTTTCTTGGAGAATGCAAGTTGTTTAACTCAAGAATGCCGTGGATGTAGAAATCCTAAAGCACATTCGC
TGTGTATCAATCCCAGTCCAGTCTTCCCAGAGAAGACTCTAAACACCTCCTGGACTGCACCTGGGCCTATGCCAATTCCT
ATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAG
CGAGTGACAACAGAAGCCTACATTTCAATGTGAGCCAGTTCCCCAAGGCTCAGAAAAGCTGCTCGAGACATGTGGAGTCA
CCCCATTTGCAGTGTAGCTGGGGGAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCA
GCTAAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGGGACAATCCTCCTGATCTC
AGGACTTTGCTGTCTTAGTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGGGTAACTTCTAAAGAAGAGATTGGTT
TGCCTCACCGTTCTGCAGGCTGTACTGGAAGCATGGCACCAGCATCTATTTCTTATGATGGCCTCAGGCCGCTCCCACTC
TGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCACAGAGATCACACGGCAAGAGAGGGAGCAAGGGGGAGGGGGAG
CAATGGAGCTTCCAAGCTCTTTTTAACAACCAGCTCTCCAGGAACTAATAGAGAGGGAACTTGCTAACCCCGTCTCCTTG
GGACAGCATTGATCTGTTCATGATGGATCCACCTCCATGACCCAAACACCTCCCAAGAGGCCCAACCTCCCACACTGGGG
GTTAAATTTCAATGTGAGGTTTGAAGGGGTCAAACATCTCAACTAAAGTAGTTGTATCCTCAGCACGTTCCATGGTTACT
ATGAGAGCTATAACTGAGAAAGCAGGAGGAAGCTAGATCTCCCGCCATCTGGGTGCTTGTCCGAAAGAGATGCTGTAAGT
GGTTACCTGTCAATCAAGAAATGCAAGACAATTCATATAGAGAAACTGCTATGATTAGCTTCTTACTGGTGTCTCCTCTT
CTTCCAGGTAACCCCAGACACCTGCACATTCTGATTGGGACCTCAGTGGTCATCATCCTCTTCATCCTCCTCCTCTTCTT
TCTCCTTCATCTCTGGTGCTCCAACAAAAAAAGTAAGTCTCACGGGGCACAGGCCAGAGAGCTCAGGGCCATGTGGGGAA
GCAGGATGGGAGCACACAGCTGTGTGTTCCTCACTGGCAGGATGGTCCCTGGCCCAAGACAGGAGCCACAGAGGCAGGAC
TTTCTAGAGAGAGCACCAGACTCCCTGCCCCTGCCTTCAGCTCACAGACCGTTGCCTGATTCTGAACTGTATCCTCATGT
CCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGAGACAGAATCAATGGGATGGGAACTCA
GAGCTATTCATGGGATGGGTCCTTGAGCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGGC
ACCTATGGCCTCCCCCTGTTTGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTCTTTTGTTGACT
TCCGTCTCCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGCCAACAGCGAGGTAGGTGCTCCTC
GGCCCAGCCTCGTGGCTAGTGTTATTCCCAAACAGTCCTGGAAAACGTGAGCACCCTCCCTCACTCAGCATTTCCCTCCC
TCACTCAGCATTTCCCTCTCTCCAGGCACCACAGTCAGGCCTTGAGGACGTCTTCTAGGGAGACAACAGCCCTGTCTCAA
AACCGAGTTGCCAGCTCCCATGTACCAGCAGCTGGAATCTGAAGGCGTGAGTCTTCATCTTAGGGCATCGCTCCTCCTCA
CGCCACAAATCTGGTGCCTCTCTCTTGCTTACAAATGTCTAGGTCCCCACTGCCTGCTGGAAAGAAAACACACTCCTTTG
CTTAGCCCACAGTTCTCCATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTACTTGAGG
CTGCAATCACACTGAGGAACTCACAATTCCAAACATACAAGAGGCTCCCTCTTGACGTGGCACTTACCCACGTGCTGTTC
CACCTTCCCTCATGCTGTTTCACCTTTCTTCGGACTATTTTCCAGCCTTCTGTCAGCAGTGAAACTTATAAAATTTTTTG
TGATTTCAATGTAGCTGTCTCCTCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR