Allele Report for 2DS5*0020104


2DS5*0020104
Previous Designations & Local Names: LUCE_Bdel_Telomeric
IPD Acc No: KIR00433
Assigned: 28-AUG-2009 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182355  
Cells Sequence Derived From: LUCE  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (304 aa)
MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGTFNHTLRLIGEHIDGV
SKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHL
SREGEAHERRLPAGPKVNRTFQADFPLDPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNSSNSWPSPTEPSSETGN
PRHLHVLIGTSVVKLPFTILLFFLLHRWCSNKKNASVMDQGPAGNRTVNREDSDEQDHQEVSYA
Nucleotide Sequence Data (915 bps)
ATGTCGCTCATGGTCATCAGCATGGCGTGTGTTGCGTTCTTCTTGCTGCAGGGGGCCTGGCCACATGAGGGATTCCGCAG
AAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCA
TGTTTGAGCACTTCCTTCTGCACAGAGAGGGGACGTTTAACCACACTTTGCGCCTCATTGGAGAGCACATTGATGGGGTC
TCCAAGGGCAACTTCTCCATCGGTCGCATGACACAAGACCTGGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTC
CCCCTATCAGTTGTCAGCGCCCAGTGACCCTCTGGACATCGTGATCACAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTCTGGCAGGAGAGAGCGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTA
TCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGGGCCCAAGGTCAACAGAACATTCCAGGCCGACTTTCCTCT
GGACCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGACTCTCCATACGAGTGGTCAAAGTCAAGTG
ACCCACTGCTTGTTTCTGTCACAGGAAACTCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCGAAACCGGTAAC
CCCAGACACCTACACGTTCTGATTGGGACCTCAGTGGTCAAACTCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCG
CTGGTGCTCCAACAAAAAAAATGCATCTGTAATGGACCAAGGGCCTGCGGGGAACAGAACAGTGAACAGGGAGGATTCTG
ATGAACAGGACCATCAGGAGGTGTCATACGCATAA
Genomic Sequence Data (15248 bps)
GTTCGGGAGGTTGGATCTGAGACGTGTTGTGAGTTGGTCATAGTGAAGGACGCGAGGTGCCAATTCTAGTGAGAACAATT
TCCAGGAAGCCGTGTTCCGCTCTTGAGCAAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCCT
CCCGTGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTAGGGGT
GCGGCCGCCTGTCTGCACCGGCAGCACCATGTCGCTCATGGTCATCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAA
TAGAGGGAGGGAGCGCGGGGATGGAGATCTGGGCCCAGAGGTGGAGATATAGGCCTGGAGGTGGAGTTATGGGCCTGGAG
TGGAGATCTGGGCCTGGAGGGGATATATGGGCCTAGAGATGGAGTGATGGGCCTAGAAGTGGAGATCTGGGTCTGGAGTG
GAGATATGGGCCTGCAGTGGAGATATGGGCCTGGAGTGGAGAGAGGAACCTGGAGAAGAGATAGGAACCTGGATGGGAGG
TAGGAGCCTAGGGTGGAGATATGGGACTGGAGTGGAGATATGGGACTGGAGTAGAGATATGGGCCTGGAGTGGAGTTATG
GGCCTGGAGTGAAGTTATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGGTGCAGATATGGA
CCTGGAGTGGAGATATGGCCCTGGAGTGGAGATGTGGGTCTGGAGTGGAGATATGGGCCTGGAGGTGGAGATAAGGGCCT
GGAGTGGAGATATGGGCCTGGAGTGGAGATATGAGCCTGGAGATGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGA
GGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCGTGGGGTGGAGATATGGGCCTTGAGTG
GAGATATGGGACTGAAGTGGAGATATGGGTGTGGGGTGGAGATATGGGACTGGAGTGCAGATATGGGCATGGGGTGGAGA
TATGGGACTGGAGTGGAGATATGGGCGTGGGGTGGAGATATGGGACTGGAGTGGAGATATGGGCGTGGGGTGGAGATATG
GGCCTGGAGTGGAGATATGGGACTGGAGTGGAGATATGGGCGTGGGGTGGAGATATGTGCCTGGAGTGGAGATATGGACG
TGGGGTGGAGATATGGGCCTGGAATGGAGATATGGGCCTGGAGTGGAGATATGGGCGTGGGGTGGAGATATGGGACTGGA
GTGGAGATATGGGCCTGTTGTGGAGATATGGGCTTGGAGTGGAGATATGATCCTGGAGTGTAGTTATGGGCCTGGAGGTG
GAGATCTGGGCCCAGGGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGGGAGGAGATATGGGCCTGGAGTGGAGA
TATGGGCCTGGACTGGAGTTATGGACCTAGGGTGGAGATCTGAGCCTGGATTGGAGATGTGGGCCCAGATTGGCTATATG
GGCCTAGGGTGGGAATATCAGCCTGGAGTGGAGATATGTGCCTGGAGTGGAGATATGGGCTTGGGGTAGGGATATGGGAA
TGGAGGCTGGGTCTCTGCACAGCCGAGAGCCCTGTTCTTGGGTGCAGGTAGGCACTGAGGGTGAGTTTCCCTTCGGCCCA
GGAAGGGCCTGGCTACCAAGACTCACAGCCTAGTGGGGATAGCAAGGAAGGCCTGGTTTGCCTGCAGATGGATGGTCCAT
CATGATCTTTCTTTCCAGCGTTCTTCTTGCTGCAGGGGGCCTGGCCACATGAGGGTAAGTCCTTCTCCAAACCTTAAGGT
GTCATCTCCCCACATAAGAGGATTTTCCTGAAACGGGAGGGAAGTCCTGTCAGGGAGTCTCTCTTAAACTAGAAAGAGGG
GACCCTGGGGTGCTTGGCCCACAGTTCCGACCTTGCCTCCCTGGCCTTTCATTTCCTTGGCAGAGTCAAGTTCTGTGGGG
ACCAGGGTTACACTAGGGTGCTCAAAGCTGGGGTGTGTGGTGGGAAAGTGGTAGGAACAGCAGATCCTCTGAGGACAAAG
GTGTTACTCACACACTTCAGCGTTTCCATGACGGTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCAGAAGAGGTGGGA
AACCACAGCCATGGCCCTGACATTCCAAATCCTCTGATGGGGGCTCAGTTGTTTATTTTCATTCAGGCATCTGCTGATAT
TCCATTCTCAAAGGACATGCCCTCCACCCCATGTCTACCCTGTGTTGTTTTATGTGAGTAATCTTACAGTATTAAAATCT
AGTAGGAGTCTCTTACTCAGCACTTGCTCAAAGTTCTCAGCTGACACTTTTGTTGTAGGGAGACAGCTTGTCTTTGTGGG
ATGAGTCCTTCCTTTAGCCCTAGGCACCAAGGTGTGATAGCAGCCATAGAAATGTGGAAAGTGGGGAGAATCTTCTGAGC
ACAGGGAGGGAGGGGCGGCTCCACATCCTCCTCTCTAAGGCGGCGCCTCCTTCTCCCCAAGGTGGTCAGGACAAGCCCTT
GCTTTCTACCTGGCCCAGCCTTGTGGTGCCTCCAGAACATGTGACTCTTCGGTGTCACTCTAATCTTGGGTTTAACAACT
TCAGTCTGTACAAGGATGATGGGGTGCCTGTCCCTGAGCTCTACAACAGAATATTCTGGAAAAGCCTTTTCATGGGCCCT
GTGACCCCGTCACACACAGGGACCTATAGATGCCGGGGTTCACACACACACTCCCCCAGTGGGGGGTCGGCACCCAGCAA
CCCCCTGGTGATCGTGGTCACAGGTCAGAGGGCTCCTGTCTGGGATTCTCCTTGTCCCACCTCCTGAATCCCAGAGCTTC
TGGTAGGCATGTCCTTGAGGGTCCCTTCACGCAGGCCCTGACTGTATTTGGGGTAAAGGGGGATTGAATACAGGGAAATG
GGTGCTGTGGTGGGAAGAATAATTGTCCCCAGTGATGACTACATTCTAATCCCTGGAGTCTGTGACTATTTATGTTATAG
GGGAAGGGACTGAAGGGGAAGATGGAGCTCAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGAAGGCCTGGACTGTCCC
CCTGGGCTCAGTGTAATGACAAGTGTCCACAGGAAAGGAGGAGGAAGAGGGGAGTGGGGATTAGAGCAGCGTAATGGGAG
TCTCCATCAGCTTTGAAGGTGGAGGAAGGCCAGGAGCCATGAATGCAGGTGGCCTATAGAGGCTGGAAAAGTCAAGGAAC
TGATTCTCCTGAGTCTCCAGAGGGAACGAAACCCTACAGGTGCCTTGATTTTAGCCCAGGAAAAACAGGGCCCAACTTCT
GCCTCCAGAAATGGAAGGGGTCAGTGTGCTCTCTCCTGCTGCCATGCTGCTGATAATTTTCTACAGCAGCAACAGGAAAC
CAACACCGGAACCCAGCTCGAGGAAAAGTTAAGAAAGGACACAAGGATAGCCGGGCGTGGTGGCAGGTGCATGTAATCCT
AGCGACTTGGGAGGCTGAGGGCAGGAGAATCACTTGAACCCAGGAGACAGAGGTTGCAGTGAGCCTAGACCACACCACTT
CACTCCAGCCTGGGCAAAGGAGTGAGACTCTGTCTCCAAAATTAATTAATTAAAGAAACCAAACAAGGAGAAGGTTGGCT
ACACCAAGATCAGCAAGTGAGGGATGATGATGCCACCACCAGGCTCCATCCACATAGGGAGCGGTTGATACTCCTCCAAC
CAGCACCAGGAGCCAGGCTATGGAAGCTGGCACAGGCATGGCAAGAGTGGCTCCCAGTCCCCACCAGGAACAGGGTGTGT
GGACACTGGTGCCTGCCTTACTGATCAGTTCATACCTCCTGCCAAGGATTCCAATTCGACCAAAAGAGATTGAACCAGGC
TGCTAAGAGCCTGGATGTGCAGCCTATCCTGGTTCCTCTTCCACCCCCACATATACAGCAGGAAAGACATTAGTTCAAAA
TAGATACAACAGCCGAAGAGATGAGGCTGAGCCCAGCGGCAAGGGAATCAGAGGTTACTAGAGACAGAGGGACAGAGAAG
AGGGAGGGAGACAGATGGAAGGACCTGCACCAGGAGTTATGGGCACAGAAAAGAACATGAAGACACAGAGAGGAAGGAGA
GAGACAGACACCAGGGAGGGGAAGCCTCACTCAATCCAGGTGCCATGGATGGGATGATAAAGAGAGACACCTTCTAAATT
CACAAACTCTCTTCCTAGGATTCCGCAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGGTGAAATCAGAAGAGACA
GTCATCCTGCAATGTTGGTCAGATGTCATGTTTGAGCACTTCCTTCTGCACAGAGAGGGGACGTTTAACCACACTTTGCG
CCTCATTGGAGAGCACATTGATGGGGTCTCCAAGGGCAACTTCTCCATCGGTCGCATGACACAAGACCTGGCAGGGACCT
ACAGATGCTACGGTTCTGTTACTCACTCCCCCTATCAGTTGTCAGCGCCCAGTGACCCTCTGGACATCGTGATCACAGGT
GAGAGTGTCCAGACATTCTTCTCATTGTCATTGGGATGCAGAGTGAATGATCCAGGACTTGGAGGCCCAGGTGGTTGTAA
GGAAGATGAGCTTGGTATTCTTATGGAGAGAGACTGACTTGGTGAGGTCTGTACCAACAGAGACAGAGAAACAGGAGACA
CAAGTACAGACCAGGTGTCATAACAGAGGACACACACAGGGGCCTTTCCGAGAGTTAGAAAAGACAGAAGGAGTTAAAGG
AGACAGACAGACAGACATGTCCCAGAGAGAGGTGTCCCTCCATGCTGACTTTGCTCAGAGACCTGGCACATGTTAGAAGT
TTCATTTCTGTTTTACCTCCACAAAGTGTTCTCTACCAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTTGGGCC
CTATGGCCTCAGGCCTTCTGGCACCTACAGATGCCATGTTTATTCTGACACCTCTGCCTTCCAGGTAATGGAGAGTAATC
GTCCCAGGATATCATGGCCCCAGAACACCAACCCCTGTATGCTGTGTGAACTTGTAGTCTCCAGACTGGATTCTGAGGCT
CACATTCCAAATAACCCCACATATGAAAGGATCACTGAGAGGCACAGAGAAAAATCAGGAACACCAAAAAGCAAAGACAT
AAACACACAGAGAATGAGCCAGAGGAAGGAGATTGAGAGACTCACAGACACATAAAGAGAGAGAAAAGAGGGCAGAGGAG
TGGTGAGAATGATGGAAGGGAGCAGAGAAAAGCACTAAAATTAGAGTCATGAGGGAGAGGCACAAGGACATAGAAAGATG
GAGATGTGGGGATGAATTGCAGAGATTCCAAAGAGAACTAGAGAGACCGAGAGGCAGAGCAAGACAGATGATAGATGGAT
AGATATAGATAGATGATAAATAGGTAGATGATAGATAATAGGTTATAGATACATAGATGATGATTGATTGATTCATTAAT
AGATGAGACATAGAGATGATGATGATGAAGACAGATAGATAATACATAGAGATAGAGAGGCAGACATAGAGAAATCATAG
AGAGAGAGAGATGATACACAGATATAGATAATAGATGATTGATGGATAGATAGAAAATTGATAGATAAATAGATGATATA
TAGATATAGATGACAGGTAGAGAATTTGTAGATAGGCACGGAATAGATAAATAGATAGATCGATAGATAATAGATAGAAA
TATGCAGAAAGTTATGAACAGGACACAAAGTGAGAAACTCAGAATTAAAAAAAGTAACATCAAGTGAACCAATCCAAGGA
GAGTCAGAGAGAATAAAACAATCCAAAAAGAGAAAACATATCTAGAGGTGGGGAAGTGAGGTCAGAGACCTAGAGAGACA
GAGAAGGTGGAAGGAGGAAATAGACGTGAAGAGAGATGGGGTGGAGGGTGAGAGAGAGAGAGAGAGAGCATTAGGTCACA
GAGCAGGGGAGTGAGTTCTCAGCTCAGGTGAAGGGAGCTGTGACAAGGAAGATCCTCCCTGAGGAAAATGCCTCTTCTCC
TTCCAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCTGGCAGGAGAGAGCGTGACCTTGTCC
TGCAGCTCCCGGAGCTCCTATGACATGTACCATCTATCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGGGCC
CAAGGTCAACAGAACATTCCAGGCCGACTTTCCTCTGGACCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTT
TCCGTGACTCTCCATACGAGTGGTCAAAGTCAAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAGCCCATGGCTG
TCCCATGTCCTATGATCCTAGAGCCTTAGCTGAGGAGCTTCCTGCTGAGGATGGAGAGAAGCATGGACAGATGCAGAGAG
AAGACGCAGCCTCGGTGTGAGGGAGGGATCAGGGCACAGGATGGCAGACAGGGCACCTCCAAACCCTCCTACATGGCCTG
CATGGAGGCCCGCGGCCAGGGCTCCAGGCACCCAGGCAGATGGAGAAAGCGGTCAGGAGAGACCCAGAGGAGGGAGACTG
GGCTCAGTTTGGGGAGATCAGAGGTTCCCTCAGCCCCTCAACATTACCCATTTCCCAGAAGCCCATCCTGGCCTCTCACC
CACACAGAGATGTCATCACCAGCAATCCCTACACCCTTTACTTTTCTTTGAAGAAATATTTATTGAGGATAAATATACCT
ATATAGCTTACCACCTTTAACATTTTTTTTTGAGGTGGAGTCTAGCTCTGTCCCCTATGCTGGAGTGCAGTGGCACAATC
TCAGCTCACTGCAACCTCCGCCTCCTGGGTTCAAGCGATTCTCCTGCCTCAGCCACCTGAGTAGCTGGTGCTACAGGCAC
GCACCACCATGCCAGGCTACTTTTTGTATTTTTAGTAGAGAGGTGGTTTCACCATGTTGGTCGAGCTGGTCTCGAACTCC
TGACCACATGATCCACCCGCATCAGCCTCCCAAAGTGCTGGGATTACAGGCATGGGCCACCGCACCCAGCCACATTTACC
ATTTTTAAGTGTAAAGTCTAGTGGTCATAAATACATTTATATATATATATATATACATTTTTTTTACCCTCCACCCTTTT
CTTCCTGTCCTCCAGTAGCCACCATTCTACTCTCTACCTTCATGAGATCCACCTTTTAGCTCCTGTATATGGGTGAGAAA
TGGGAATCTTTGTAATGACCTCCAGTTCCATCCATGTGGCTGCAAATGACAGGATGTTATTCTTTCTATGGATGAGTAGT
CTCCACTGTGCGTATGTACTACATTCTCTCTATCCATTCACCCACTGATGGGCAGGTAGGTTGACTCCTCATCTTGGCTA
CTGTGAACAGTGCTGCACCAATCATACGAGTGCAGATATCACTTCGATATATTGATTTACTTTCCTTTGGATATAAACCC
AGTAGTGAAATTGCTGGATACTATGAAAGTTCTCTTTTTTTTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGCCC
AAGCTGGAGTCAAAGTGGTGCGACCTTGGCTCATTGCAACCTCCGCCTCCTGGGTTCCAATGATTTTCCTGCCTCAGCCT
CCCTAGTAGCTGGGATTACAGGTGCACGCCACCATGCCTGGCTACTTTTTGGTTTTTTTAGTATAGATGCGGTTTCCCCA
TGTTGGCTGGGCTGCTCTCAAACTCATGACCTCAACTGAGGTGCCCGCCTCAGTCTCCCAAAGTGCCGGGATTACAGGCC
TGATCCACCACACCCAACCTCTTTTTAGTTCTTTAAAGGACTTCCATACTTTTCTCCGTAATCGCTGTACTAATTTACAC
TCCTCCCAACAGGGTACCAGGGTTCTCCTTTCTCTACCACCTTGCCAGCATTTCTTTTGCCTGTCTTGCAGCTAAAAGCC
ATTTTATTTTATTTCATTTTATTTTGAGGTGGAGTTTCGCTCTTGTCACCCAGGCTGAGTGCAGTGGTGCGATCTCGGCT
CACCGCAACCTCCACCTCCCAGGTTCAAGCGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGAATTACAGGCACACGCCA
CCACGCCCTACTAATTTTTGTATTTTTAGTAGAGACAGCGTTTCTCTATGTGGGTCATACTGGTCTCAAACTCCCGACCT
TATGAGATTCACCCACCTCAGGCTCTCAAAATTCTAGGATGACAGACGTGAGCCACCTCGCCCGGCCTAAAAGCCATTTT
AATGGAGTGAGATGAAAACTCACTTTGATTTTAATTTGCGTTTCTCTGATGATGAGTGATACTGAGCAGTTTTTCGTATG
TGGGGAAATTTCATGTCTTTTGCTCCTTTTTCAATTAAATCATTTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCTA
GTTATTAATCCCATCTCAGATGCATAGTTTGCACATATTTGCTCCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTA
TTTTTAGCAGTGCAGAAGTTGCTTAGTTTGAGGTAATCCCAATGGTCTATTTTTGCTTCGATTACTTGTGTTTTCAAGGT
TTAAAACAAAATGTCTTTCTTCAGACAAATGTCCTGGAGCATTTCCCCAATATTTTGTTCTACGTGTTTCATAGGTTCAG
GCCTTAGACTCACATCTTTAATCCATTTTCATTTGATTTTTGTGTATGGTGACAGGTAGAGGTGCAGTTTCATTCCTCTG
CATGTCGATGTCCAGGTTTCCCTGCACTGTTTATTGAAAAGACTGTCCTTTCCTGATTGTGAGTTCTTGGCACCTTTGTC
AAAGTCCATTGGATGGGCTGGGCTTGGTAGCTAACACCTGCAATTTCAGCACTTTGGGAGGCCGAGGCGGGTGGATTACC
TGAGGCCAGGAGTTCAAGATCAGTCTGGACGACGTGATGAAACATCGTCTCCACTAAAAATATAAAAATTAGCTGAGCAT
GGTGGTCAGCACCTGTAATACCACTACTCAGGAGTTTGAGGCAAGAGAATGATTGAACCCAGGAGGCTGAGGTTGCAGTG
AACTGAGATTGCACCTCTGCACTCCAGCCTGAGTGACAGAGCAAGACTCCATCTCAAAAGAAAAAATAAAAACCATTGGA
TGTAAATGCATGGAATATATCTGTGTTATTCATTCTGCTCCATTGTTCTATGTGCCTTTCTTTATGCCAATGTCATGCTG
TTTTGCTTACTACAGCTCTGTAACATATTTTGAGATCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTGAAGTCT
CAAGACAGTGGGTGTCACATAAAAAAATTATGGAAAAAAGGATCCCAGGACTCCCAGGGCCCAATATTAGATAACAGAGT
GTTGGCCATGAACCATCCTCAAAGATTTCCACTGAGTAGAGGACAGACACCCTCATTTCCTCACCTCTCTCCTGTCTCGT
GTTCTAGGAAACTCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCGAAACCGGTGAGTACAGAACCCTCTTATA
TCCGCTTTTGGAAACCTGGGGAGGTGGAAACCTTGGATTCAGGCGTTGACTCAGCATCTCACAGCTCTGACATTGTACCC
CTGTCTTCCACCATCTCCGAACTCCAGATACTCCAACAGCGAAAGGGATCTGGGCCCAACACAGGGCTCAGTGAAATCTC
TTCATCCCTCATTTTATGGAGCTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAA
TGCAATGTTTGTTCTGCCTGCATTCCTAACTGGAGGATAAATTCCTGGAGACTTGAGAGAGGGAAGGGAAGGGAACATCT
GATGAGGGCGAGGTGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAGCTCCTGTAGGTCATGAAGCAACCCTGGCTGACT
CCGCAGAGAAAGCGCCTTGCCGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCAGCCACGG
CCCCATGCTCAGGCTGTGCAGTGTGGAAGCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAAC
AAAACGGTTTTTTAATTATCTTACAGTGCTCTAGCTCAAAGTATGAAGTGCATCTCACTGGGCTAAAATCAAGGCGACAG
CAAGGCTGCCTTCCCTCTGAGGGTTCCAGGCAAGAATCTGCTTCTCACTTGTCCCAGCTTCTAGAGGCTCCCACATTCCT
TCGCTCCTGGTCCCCTTCCTCCTTCCTCAAAGCCCACAAAGGCTGGTCACATCTCACGTGGCATCACTCAGACCCTTCTT
CCTTACCACACCTCTTTATCTGAATGCTGCTCTCCCTTCTTCCTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCAC
CAAGATGAAAATCCATCATAATCTCCAGGAAATCATTCAGGATACCCTTGTTTTAAGTTCAGCTGATTAGCAACCATAAT
TCCATCTGCAATCTTCATTCCTCCTTTCCATGTAAAATAAGATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTG
GGGTGGGACAGCATTCTCCTACCTTCCACAAACAGTGAACAAGATGCATTTGGCCTCTGCCCTTGGGACACTGATATTGC
AGATGGTTAAATGGGAGGGCAGAAAATGAATGCACAAGTGGACCAATAAATGAATGATCCATTGGGAAGCATCTGTGTAT
GAAATCTATTTGTTTGTTTCTTCGTTTGTTTATTGAGACAGAGTCTCCCTCCGTCTTCCAGGCTACAGTGCAGTGTCACC
ATCTTGGCTCACTGCAACCTGCACCTTCTGGATCCAAGTGATTCTCCTGCGTCAGCCTCTCGAGTAGCTGGGATTACAGG
CAACTGCCACCATGCCCGGCTAATTCTTTTTGTATATTTTTTGTAGAGGATGTTTCACCATCTTCGCCAAGCTTCTCTGA
AACTCCCAACCTCAAGTGATCCGACCGTCTCAGCATCCTAAAGTACTGGGATAACTGGCGTGAGCCACTGTGCCCAGCCA
GAATTTAAAATAAATAATACATAATGCTGAGTGTATGATTTTGGGTGACAGAGAAGATCTCACTAATCAGATATTTGTGA
CATTAATGAAAAACACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTTTCCACACACAGCTGTCAGCCGTGAAGGCAG
AAAGCTGAAAACAATCTGATGTGGAAGGAAGAGGCTCTGCCTCAAATGCTGGGAATGAGATGGGGAGAATGACAAGACGA
CTGTGGAGAGACGGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCAT
TGGATTCACCTCGGGGTAGCCAGGAATCCCTACATGATTAATAGTGACTGACATGAAAATAAGGGAGGCCCAGGTGCGTA
ACTGGAATCTAGGAGACCGTGGAAAAGGCAATTCCCGCCTCACTGGTGAAATGTGGTGCTGATTTAGACCCTAACTGGGT
GAAGCAGATGGATATAAGATATGCTTGTGAGGTGGAATCATTGGCTGGAAAGGCTTGCTGGGTATGATTTTCCTAGTTGT
CTAATCCTCGCTTAATTTCTTTCTGAGCTTTATTCCTACTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATAT
GAGGGGTGGTGGAAATGAAGGGACCTATTACAGCATAATATACAAGTCTGTGAACGGTGGCTCACGCCTGTAACCCAGCA
CTGCAGGAGGCCAAGGCGGGTGGATCACACGAAGTCAGCAGTTCGAGACCAGCCTGGCCAACATGGTGAAACCCTGTCTC
TAGGAAAAACACAAAAATTAGCCGAACATGGTGGTGCATCCCTGTAATGCCAGCTCCTACTCTGGAGGATGAAGCAGGAG
AATGACTTCAACCCAGGAGGTGGAGTTTGCAGTGAGTGGAGATTGCATCACTGCACTCCAGCCTGGGTGACACAAGGAGA
CTCCGTCTCAAAAAATAAAAATAAGAAATGCATAAATATAAATATAATATAACACACGCAAATGACAAAGGGACCTGAAT
TCCAATCATGATTTTTCTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATGAGCCTAAAACCT
CTTCCCTATTTGGCTTTCTGTGAGCATGAGATCATATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCACAGATCCTGG
AATACACAAAGTGCTCTGTTCATCACAAAAAAAACATGCCCTCTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCA
TCTGTGGAGATTCAGATAGGCCATGGGGAGGTAAATTCTAATACTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATC
AGCGTCAGCACTAGCTCCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTATTGAAGCAATAGATGGCCGAGG
GTGTGGTCCTTCCCCCAGCCTCTGGGGTAGAACAGCAGCCTAACATGTGTCTCCTGAGATCACAAAGAGTAGCACGTTTC
ACATGGGCTTCAACACTATTTCCTGGCCATTTGACATAAGAGAATTCTACTTCGCTTTTTTTATCTTGATTTCACTTTTG
TTTCCTTTTCTTGGAGAATGCAAGTTGTTTGACTCAAGAATGCCGTGGATGTATAAATCCTAAAGCACATTCGCTGTGTA
TCAATCCCAGTGCAGTCTTCCCAGAGAAGACTCTAAACACCTCCTGGACTGCACCTGGGCCTATGCCAATTCCTATCACT
CACCGTCACTCCAGGAAGACAGAACACACAGAGAATACATTACACAGGCAGGTTCATTACTAACAGATAAGCAGTGAGTG
ACAACAGAAGCCTACATTTCAATGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTGCTCGGGACATATGGAGTCACCCCAT
TTGCAGTGTAGCTGGGGGAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAA
GCACTGCATGACGCCTTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGAGACATTCCTCCTGATCTCAGGACG
TTGCTGTCGTAGTTTTTTTTTGTTGCTCTAAAGGAAAACTTGAGCCTCGGTAACTTCTAAAGAAAAGAGATCGGTTTGCC
TCACCGTTCTGCAGGCTGTACTGGAAGCATGGCACCAGAATCTATTTCTTGTGACGGCCTCAGGCTGCTCCCACTCTGGC
AGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCGCAGAGATCACACGGCAAGAGAGAGAGTAAGGGGGAGGGGGAGCGAT
GGAGCTTCCAAGCTCTTTTGAACAACCAGCTCTCCGGGAACTAATAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGAC
AGCATTGTTCTGTTCATGATGGATCCACCTCCATGACCCAAACACCTCCCAAGAGGCCCAACCTCCCACAGTGGGGGTGA
AATTTCCATGTGAGGTTTGAAGGGGTCAGACATCTCAACTAAAGTAGTTGTATCCTCAGCACGTTCTATGGTTACTATGA
GAGCTATAATTGAGAAAGCAGGGGAAAGCTAGGTCTCCCACCATTTGGGTGCTTGTCCTAAAGAGACGTTGTATGTGGTT
ACCTGTCAATCAAGAAATGCGAGACAATTCATAAAGAGGAACTGCTATGATTAGCTTCTTATTGGTGTCTCCTCTTCTTC
CAGGTAACCCCAGACACCTACACGTTCTGATTGGGACCTCAGTGGTCAAACTCCCTTTCACCATCCTCCTCTTCTTTCTC
CTTCATCGCTGGTGCTCCAACAAAAAAAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAG
GATGGTAGCACGCGGGTGTGTGTTCCTCACAGGCAGGATGGTCCCTGGCCCAAGGCAGGAGCCACAGAGGCAGGACTTTC
TAGAGAGAGCACCAGATTCCCTTCCCCTGCCTTCAGCTCACAGACCATTGCCTGATTCTGAACTGTACCCTCACGTCCCC
TGCAGCCACTCACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGAGATAGAATCAATGGGATGGGAACTCAGAGC
TATTCATGGGATGGGTCCTTGAGCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGGCACCT
ATGGCCTCCCCCTGTTTGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTGTTTTGTTGACTTCCA
TCTTCTACAGATGCATCTGTAATGGACCAAGGGCCTGCGGGGAACAGAACAGTGAACAGGGAGGTAGGTGCTCCTCGGCC
CAGCCTCGTGGCTAGTCTTATTCCCAAAGAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCA
GGATTCTGATGAACAGGACCATCAGGAGGTGTCATACGCATAATTGGATCACTGTGTTTTCACACAGAGAAAAATCACTC
CCCCTTCTCAGAGGCCCAAGACACCCCCAACAGATACCAGCATGTACATAGAACTTCCAAATGCTGAGTCCAGATCCAAA
GCTGTCTTCTGTCCACGAGCACCACAGTCAGGCCTTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGG
TTGCCAGCTCCCATGTACCAGCAGCTGGAATCTGAAGGCATCAGTCTTCATCTTAGGGGATCGCTCTTCCTCAAACCACG
AATCTGAACATGCCTCTCTCTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAGAAAACACACTCCTTTGCTT
AGCCCACAATTCTCCATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTACTTGAGGCTG
CAATCACACTGAGGAACTCACAATTCCAAACATACAAGAGGCTCCCTCTTAACACAGCACTTAGACACGTGCTGTTCCAC
CTTCTCTCATGCAGTTCCACCTCCCCTCAGACTATCTTTCAGCCTTCTGTCAGCAGTAAAACTTATAAATTGTTTTTAGT
AATTTCAATGTAGTTTTCCCTCCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR