Allele Report for 2DS4*0060102


2DS4*0060102
Previous Designations & Local Names: 2DS4_FH15_A_hap
IPD Acc No: KIR00651
Assigned: 31-MAR-2010 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182346  
Cells Sequence Derived From: FH15  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (240 aa)
MSLMVIIMACVGFFLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHREGKFNNTLHLIGEHHDGV
SKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDMVIIGLYEKPSLSAQPGPTVQAGENVTLSCSSIYPGRGRPM
NVGSLQCAASTEHSRPTFLWALPPTEGPTDASALSVTLPTSGQTRVIHCLFPSQETLQIVGLHPLNQAPKPVTPDTYMFX
Nucleotide Sequence Data (893 bps)
ATGTCGCTCATGGTCATCATCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACAGGAGGGAGTCCACAG
AAAACCTTCCTTCCTGGCCCTCCCAGGTCACCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCGGATGTCA
TGTTTGAGCACTTCCTTCTGCACAGAGAGGGGAAGTTTAACAACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTT
TCCAAGGCCAACTTCTCCATTGGTCCCATGATGCCTGTCCTTGCAGGAACCTACAGATGCTACGGTTCTGTTCCTCACTC
CCCCTATCAGTTGTCAGCTCCCAGTGACCCTCTGGACATGGTGATCATAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCATCTATCCAGGGAGGGGGAGGCCCATG
AACGTAGGCTCCCTGCAGTGCGCAGCATCAACGGAACATTCCAGGCCGACTTTCCTCTGGGCCCTGCCACCCACGGAGGG
ACCTACAGATGCTTCGGCTCTTTCCGTGACGCTCCCTACGAGTGGTCAAACTCGAGTGATCCACTGCTTGTTTCCGTCAC
AGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTAACCCCAGACACCTACATGTTCTGA
TTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCTCCGACAAAAAAAAT
GCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGATTCTGATGAACAAGACCATCAGGAGGT
GTCATACGCATAA
Genomic Sequence Data (15897 bps)
GTTTGGGAGGTTGGATCTAAGACGTGTTTTGAGTTGGTCATAGTGAAGGACGCGAGGTGTCAATTCTAGTGAGAGCAATT
TCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACACACTGGGCCTCATGCAAGGTAGAAAAAGCCTGCGTACGTCACCCT
CCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCG
CGGCCGCCTGTCTGCACCGGCAGCACCATGTCGCTCATGGTCATCATCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAAT
AGAGGGAGGGAGCGTGGGGATGGAGATCTGGGCCCAGAGGTGGAGATATGGGCCTGGAGGTGGAGTTATGGGCCTGGAGT
GGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTAGAGATGGAGTGATGGGCCTAGAAGTGGAGATCTGCGCCTGGAGTGG
AGATCTGGGCCTGGAGTGAAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGGGATAGGAACCTGGAGTGGAGAG
AGGAACCTGGAGGAGAGATAGGAACCTGGAGGGGAGGTAGGAGCCTAGGGTGGAGATATGGGACTGGAGTGGAGATATGG
GACTGGAGTGGAGATATGGGCCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTATGGGCCTGGAGGTGGAGATATGGGCC
TGGAGTGGAGATATGAGCCTGGAGTGGAGATATGGTCCTGGAGTGGAGTTATGGGCCTGGAGTGGAGATATGGGTCTGCA
GTGGAGATATGGGCCTGGAGGTGGAGATATGGGTCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTATGGGCCTGGAGGT
GGAGATATGGGCCTGGAGTGGAGATATGGGACTAGAGTGGAGATAGGGGCCTGGAGGTGGAGATCTGGGCCTGGAGTGGA
GATGTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGCAGTGGAGATA
TGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTATGGGCCTGGAGGTGGAGATATG
GGCCTGGAGTGGAGATATGGGACTAGAGTGGAGATACGGGCCTGGAGGTGGAGATCTGGGCCTGGAGTGGAGATATGGCC
CTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGAGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATATGGCCCTGG
AGTGGAGATATGGGCCTGGAGTGGAGATATGAGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTG
GAGATATGGGCCTGGAGTGGAGATATGGGTCTGGAGTGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAG
ATATGGGCCTGGAGGTGGTGATATGGGCCTGGAGTGTAGATATGGGCCGAGTGGAGATATGGGTCTGGAGTGGAGATATG
GGCCTGGAGTGGAGATATGGGACTGGAGTGGAGATATAGGCATGGGGTGGAGACATGGGCCGGGAGTGGAGATATGGGAC
TGGAGTGGAGATACGGACGTGGGGTGGAGATATGTGCCTGGAGGTGGAGATATGGGCGTGGGTTGGAGATATGGGCCTGG
AGTGGAGATATGGGCGTGGGGTGGAGATATGGGTCTGGAGTGGAGACATGGGCATGGGGTGGAGATATGGGCCTGGTGTG
TAGATATGGGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATCTGGGCCTACGGTGGAGA
TATGGGCCTAGGATGGGGATATGGGCCTGGAATGGAGATATGGGCCTGGGTGTGGAGATATGGGACTGGAGTGGAGATAT
GGGCCTGATGTGGAGATATGGGCTTGGAGTGGAGATATGATCCTGGAGTGTAGTTATGGGCCTGGAGGTGGAGATCTGGG
CCTGGGGTGGAGATATGGGCCTGGAGTGGAGATATGGGACTGGAGAGGAGATATGGGCCTGGAGTGGAGATATGGGCCTG
GATTGGAGATATGGGCCTAGGGTGGAGATCTGAGCCTGGATTGGAGATGTGGGCCCGGATTGGCTATATGGGTCTAGGGT
GGAAATATCGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCTTGGGGTGGGGATATGGGCCTGGAGGCTGG
GTCTCTGCACAGCCGAGAGCACTGTTCTTGGGTGCAGGTAGGCACTGATGGTGAGTTTCCCTTCGGCCCAGGAAGGGGCT
GGCTATCAAGACTCACAGCCCAGTGGGGGCAGCAAGGAAGGCCTTGTTTGCCTGCAAATGGATCTTCCATCATGATCTTT
CTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACAGGAGGGTAAGTCCTTCTCCAAACCTTAGGGTGTCATCTCCC
CACATAAGAGGATTTTCCTGAAATGGGAGGGAAGTCCTGTCAGGGAGTCTCTCATAAACTAGGAAGAGGGGACCCTGGGG
TGCTCGGCCCACAGTTCCGACCTTGCCTCCCTGGCCTCTCAACCCCTTGGCAGAGTCAAGTTGTGTGGGGACCAGGGTTG
GACTAGGGTGTTCAAAGCTGGGTTGTGTGGTGGGGAAGTGGTAGGAACAGCAGATCCTCTGAGGACAAAGGTGTTACTCA
CACACTTCAGCGTTTCCATGACGGTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCAGAAGAGGTGGGAAACCACAGCC
ATGGCCCTGACATTCCAAATCCTCTGATGGGGGCTAAGTTTTTTATTCTCATTCAGGCAACTGCTGATATTCCATTCTCA
AAGGACATGCCCTCCACTTCATGTCTACCCTGTGTTGTTTTATGTCAGTAATCTTACAGTATTAAAATCTAGTAGGAGTC
TCTTACTCAGCACTTGCTCAAAGTTCTCAGCTGACACTTTTGTTGTACGGAGACACCTTGTCTTTGTGGGATGGGTCCTT
CCTTTAGCCCTAGGCACCAAGGTGTGATAGCAGCCATAGAAATGTGGAAAGTGGGGAGAATCTTCTGAGCACAGGGAGGG
AGGCACAGCTCCACATCCTCCTCTCTAAGGCGGCGCCTCCTTCACCCCAAGGTGGTCAGGACAAGCCCTTGCTTTCTACC
TGGCCCAGCCTTGTGGTGCCTCCAGAACATGTGACTCTTCAGTGTCACTCTAATCTTGGGTTTAACAACTTCAGTCTGTA
CAAGGATGATGGGGTGCCTGTCCCTGAGCTGTACAACAGAATATTCTGGAAAAGCCTTTTCATGGGCCCTGTGACCCCGT
CACATGCAGGGACCTATAGATGCCGGGGTTCACACACACACTCCCCCAGTGGGTGGTCGGCACCCAGCAACCCCCTGGTG
ATCATGGTCACAGGTCAGAGGGCTCCTGTCTGGGATTCTCCTTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTAGGCAT
GTCCTTGAGGGTCCCATCACGCAGGCCCTAACTGTATTTGGGGTAAAGGGGGATTGAATACAGGGAAATGGGTGCTGTGG
TGGGAAGAATAAGTGTCCCCAATGATGACTGCATTCTAATCCCTGGAGTCTGTGACTATTTATGTTATAGGGGAAGGGAC
TGAAGGGGAAGATGGAGCTCAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGACAGCCTGGACTGTCCCGGTGGGCTCA
GTATAATCACAAGTGTCCACATGAAAGGAGGAGGAAGAGGAGAGTGGGGATTAGAGCAGCGTAGTGGGAGACTCCATCAG
CTTTGAAGGTGGATGAAGGCCATAAGCCATGAATGCAGGTGGCCTATAGAGGCTGGGAAAGTCAAGTAACTGATTCTCCT
GAGTCTCCAGAGGGAACACAGCCCTGCAGATGCCTTGATTTTAGCCCTCAAAAAACAGGGTCCGCTTTCTGTCTCCAGAA
TCGGAGGGGGTCAGTGTGCTCTCTCCTGCTGCCATGCTTCTGATAATTTTCTACAGCAGCAACAGGAAACCAACACTGGA
ACCCAGGTCAAGGACAAGTTAAGAAAAGACACAAGGATAGCCAGGCATGGTGGCAGGTGCATGTAATCCTAGCGACTCAG
GAGGCTGAGAGCAGGAGAATCGCTTGAACCCAGGAGACAGAGGTTGCAGTGAGCGTAGACCACACCACTTCACTCCAGCC
TGGGCGAAGGAGTGAGACTCTGTCTCCAAAATTAATTAATTAATTAAAGAAACCAAACAAAGAGAAGGTTGGCTACACCG
AGATCAGCAAGGGTGGGATGATGATGCCACCACCAGGCTCCATCCACATAGGGAGGGGTTGATACTCCTCAAATCAGCAC
GAGGAGCCAGCCTATGGAAACTGGCACCATGGAGAAGGCACAGACATGGCAAGAGTGGCTCCCAGTCCCCACCAGGAACA
GGGTGTGTGGACACTGGTGCCTGCCTTACTGATCAGTTCATACCTCCTGCCAAGGATTCCAATTCGTCCAAAAGAGATTG
AACCAGGCTGCTAAGAGCCGGGACGTGCAGCCTATCCTGCTTCCTCTTCCACTCCCACATAGACAGTAAGAAAGACATTA
GTGTGAAATAGATACAACAGCCCAAGAGATGAGGCTGAGCCCAGTGGGAAGGGAACCACAGCTACTAGAGACAGAGGGAC
AGAGAAGAGGGAGGGAGACAGATGGAAGGACCTGCACCAGGAGTTATGGGCACAGAAAAGAACATGAAGACACAGAGAGG
AAGCAGAGAGACAGACACCAGCGAAGGGAAGGCTCACTCATTCCAGGTGCCATGGATGGGATGATAAAGAGAGACACCTT
CTAAACTCACAACCTCTCTTCCTAGGAGTCCACAGAAAACCTTCCTTCCTGGCCCTCCCAGGTCACCTGGTGAAATCAGA
AGAGACAGTCATCCTGCAATGTTGGTCGGATGTCATGTTTGAGCACTTCCTTCTGCACAGAGAGGGGAAGTTTAACAACA
CTTTGCACCTCATTGGAGAGCACCATGATGGGGTTTCCAAGGCCAACTTCTCCATTGGTCCCATGATGCCTGTCCTTGCA
GGAACCTACAGATGCTACGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCTCTGGACATGGTGAT
CATAGGTGAGAGTGTCCAGACATTCTTCTCATTGTCATTGGGATGCAGAGTGAATGATCCAGGACTTGGAGACCCAGGTG
GTTGTAAGGAAGATGAGCTTGGTATTCTTATGGAGAGAGACTGACTTGGTGAGGTCTGTGCCAACAGAGACAGAGAAACA
AGAGACACAAGTACAGACCAGGTGTCGTAACAGAGGACAAACACAGGGGCCATACAGGGAGTTAGAAAAGACAGAAAGAG
TTAAAGGAGACAGACAGACATGTCCCAGACAGAGGTGTCCTTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTTAGA
AGTTTCATTTCTGTTTTACCTCCACAAAGTGTTCTCTACCAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTTGG
GCCCTGTGGCCTCAGGCCTTGTGGCACCTACAGATGCCATGCTTATTCTGACACCTCTGACTTCCATGCAATGGAGAATA
ATCGTCCCAAAATATCATGGCCCCAGAACACCAACCCCTGTATGCTGTGTGAACTTGTGGTCTCCAGACTGGATTCTGAG
GCTCACATTCCAAATAACCCCACATATCACATATGAGAGGATCACTGAGAAGCACAGAGAGAAATCAGGGACACCAAAAA
GCAAAGACATAAACACACAGAGAAAGAGCCAGAGGAAGGAGATTGAGAGACTCACAGACACATAAAGAGAGAGAAGAGGG
CAGAGAAGTGGAGAGAATGATGGAAGAGAGCAGAGAAAACCACTAAAATTAGAGTCCTGAGGGTGAGGCACAAGGGCATA
GAAAGATGGAGATGTGGGGATGAATTGCAGAGATTCCAAAGAGAACTAGAGAGACCGAGAGGCAGAGCAAGACAGATGAT
AGATGGATAGATACAGATAGATGATGGATAGATATAGATAGATGATATATAGGTAGATGATAGATAATAGGTTATAGATA
CATAGATGATGATTGATTGATTCATTAATAGATGATACATAGAGATGATGATGATGAAGATAGATGGATAGATAATACAT
AGAGATAGAGAGGAAGACAAAGAGAGAAATAATAGAGAGAGAGAGATGATACATATATATAGATAATAGATGATTGACGG
ATAGACAATTGATAGATAAATAGATGATATATAGATATAGATGACAGGTAGAGAATTTGTAGATAGGCACCGAATAGATA
AATAGATGGATTGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACGGGACACAAACTGAGAAACTCAGAGTTAAA
AAAAGTAACATCAAGTCAACCAATCCAAGGAGAGCCAGAGAGAATAAAACAATCCAAAAACGGAAAACATAACTAGAGGT
AGGGAAGTGAGGTCAGAGACCTACAGAGACAGAGAAGGTGGAAGGAGGAAATAGACATGAAGAGAGATGGGGTGGAGGGT
GAGACAGAGAAAGAGAGCATTAGGCCATAGAGCAGGGGAGTGAGTTCTCAGGTCAGGTGTGAGGGGAGCTGTGACAAGGA
AGATCCCCCCTGAGGAAACTGCCCCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCAC
GGTTCAGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCATCTATCCAGGGAGGGGGAGGCCCATGAACGTAGGCTCCC
TGCAGTGCGCAGCATCAACGGAACATTCCAGGCCGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCT
TCGGCTCTTTCCGTGACGCTCCCTACGAGTGGTCAAACTCGAGTGATCCACTGCTTGTTTCCGTCACAGGTGAGGAAACC
CCATATCTGTCCCATGTCCTATGATCCTAGAGCCTTAGCTGAGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGACAGA
TGCAGAGAGAAGACGCAGCATGCCTGTGAGGGAGGGATCAGGGCGCAGGATGGCACACACAGCACCTCCAAACCCTCCTG
CATGGCCTGCATGGAGGCCTCCGATTAGGGCTCCAGGCACCCAGGCAGATGTAGAAAGCGGTCAGGAGAGACCCAGAGAA
GGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGTTCCCTCAGCCCCTCAACCTTACCCATTTCCCAGAAGCCCTTCCTG
GCCTCTCACCCACACAGAGATGTCATCACCAGCAACCCCTACATCCTTTTCTTTTTGTTTGAAAAAATATTTATTGAGGT
TAAATATACCTATATAGCTTACCACTTTTAACATTTTTTTTTTTTGAGGTGGAGTCTAGCTCTGTCTCCTATGCTGGAAT
GCAGTGGCACAATCTCAGCTCACTGTAACCTCCGCCTCCTGGGTTCAAGCGATTCTCCTGCCTCAGCCACCTGAGTAGCT
GGTACTACAGGCGCCCATCACCACGCCAGGCTACTTTTTGTATTTTTAGTAGAGAGGGGGTTTCACCATGTTGGTCGAGC
TGCTCTGGAACTCCTGACCACGTGATCCACCCGCCTCAGGCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCGCGCC
CGGCCACGTTTACCAATTTTAAGTGTAAGGTCTAGTGGTCATAAATACATACATATAAATTTTTTGTTTGTTTGTTTTAT
CCTCCACCCTTTTCTTCCTGGCCTCTGGTAGCCACCATTCTACTCTCTATCTTCATGAGATCCACCTTTTAGCTCCTGTA
TATGGGTGAGAAATGAGAATATTTGTAATGACTTCCAGTTCCATCCATGTGGCTGCAAATATCAGGATGTTATTCTTTCT
ATGGATGAGTAGTCTCCGCTGTGCGTATGTACTACATTCTCTCTATCCATTCATCCACTGATGGGCAGGTAGGTTGACTC
CACATCTTGGCTACTGTGAACAGTGCTGCACCAATCATACGAGTGCAGATATCACTTCGATACATTGATTTACTTTCCTT
TGGATATAAACCCAGTAGTGAAATTGCTGGATACTATGAAAGTTCTCTTTTTAGTTTTTCGTTTGTTGTTTTGTTTTTGT
TTTTGAGACAGTTTCCCTCTGTGCCCAGGCTGGAGTACAAGTGATGTGATCTTGGCTCATTGCAACCTCCGCCTCCTGGG
TTCAAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCTGGGATTACAGGTGCACGCCACCATGCCGGGATACTTTTTGGTT
TTTTTTAGTGTACATGGGGTTTCCCCAGGTTGGCTAGGCTGCTCTCAAACTCATGACCTCAACTGAGGTGCCCGCCTCGG
TCTCCCAAAGTGCCGGGATTACAGGCATGATCCACTTCATCCAACCTCTTTTTAGTTCTTTAAAGGACTTCCATACTTTT
CTCCGTAATGGCTGTACTAATTTACACTCCTACCAACAGGGTACCAGGGTTCTCCTTTCTCTACCACCTTGCCAGCATTT
GTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTTATTTCATTTTATTTTGAGATGGAGTTTCGCTCTTGTCACCCAG
GCTGGAGTGCAGTGGTGCGATCTCGGCTCACCGCAACCTCCACCTCCCAGGTTCAAGCGATTCTCCTGCCTCAGCCTCCC
GAGTAGCTGGAATTACAGGCACACGCCACCACGCCCGACTAATTTTTGTATTTTTAGTAGAGACAGCGTTTCTCCATGTG
GGTCATACTGGTCTCAAACTCCCGACCTTATGAGATTCGCCCACCTCGGGCTCTCAGAGTTCTAGGATGACAGACGTGAG
CCACCTCGCCCGGCCTAAAAGCCATTTTAATGGGGTGAGATGAAAACTCACTTTGATTTTAATTCGCGTTTCTCTGATGA
TGAGTGATACTGAGCACTTTTTCGTATGTGGGGAAATTTCATGTCTTTTGCTCCTTTTTCAATTAAATCATTTGTTTTAT
TGAGTTGTTTGAGCTTCTTATACTTCTAGTTACTAATCCCGTCTCAGAAGCATAGTTTGCACATATTTGCTCCCAATCTG
TGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCGGTGCAGAAGTTGCTTAGTTTGAGGTAATCCCAATGGTCTATTT
TTGCTTCAATTACTTGTGTTTTGAAGGTTTAAAACAAAATGTCTTCCTTCAGACAAATGTCCTGGAGCATTTCCCCAATA
TTTTCTTCTACGTGTTTCACAGGTTCAGGCCTTAGACTCACATCTTTAATCCACTTTCATTTGATTTTTGTGTATGGTGA
CAGGTAGAGGTGCAGTTTCATTCCTCTGCATGTAGATGTCCAGGTTTCCCTGCACTGTTTATTGAAAAAACTGTCCTTTC
CTGATTGTGAGTTCTTGGCACCTTTGTCAAAGTCCATTGGATGGGCTGGGCATGGTGGCTAACACCAGCAACTTCAGCAC
TTTGGGAGGCCAAGGCTGGTGGATCACCTGAGGACAGGAGTACAAGATTACTCTGGCCGACGTGATGAAACATCGTCTCC
ACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCACCTGTAATACTACTACTCAGGAGTTTGAGGCAAGAGAATTG
ATTGAACCCAGGAGGCTGAGGTTGCAGTGAACCGAGATTGCACCTCTGCACTCCAGCCTGGGTGACAGAGCGAGACTCCA
TCTCAAAAGAAAAAATAAAAAAAATTGGATGTAAATGCATGGATTATATCTGTGTTCTTCATTCTGCTCCGTTGTTCTAT
GTGCCTTTCTTCATGCCAACATCATGCTGTTTTGCTTACTACAGCTCTGTAACATATTTTGAGATCAGGTAGTGTGATGC
TCCTGTTTTCTCTTTATACCTTGAAGTCTCAAGACAGTGGGCGTCACATACAAAAATTATGGAAGAAAGGATCCCTGGAC
TCCCAGGGCCCAATGTTAGATAACAGAGTGTTGGCCATGAACCATCCTCAAAGATTTCCATTGAGTAGAGGACAGACACC
CGCATTTCCTCACCTCTCTCCTGTCTCATGTTCTAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCC
AAAACCGGTGAGTACAGGACCCTCTTATATCTGCTTTTGGAACCCTGGGGAGGTGGAAACCTTGGATTCAGGCGTTGACT
CAGCATCTCACAGCTCTGACATTGTACGCCTGTCTTCTACCATCTCCGAACTCCAGATACTCCAACAGCGAAAGGGATCT
GGGCCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTCATTTTATGGAGCTGAGACCTCCTACAAGCTAGAAGAATGAT
TGCCAATCTGACATCCTTCTCAGGAAAAATGCAATGTTTGTTCTGCTTGCATTCCTAACTGGAGGATAAATTCCTGGGGG
CTTGAGAGAGGGAAGGGAAGCGAACATCTGATGAGGGCGAGGTGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAGCTCC
TGTTGGTCATGAAACAACCCTGGCTGACTCAGCAGAGCAAGAGCCTTGCCGTAACAGAGAACAGAGCTCATGCACGCACA
CTTCGACTCACTGACTTATTCAGCCATGGCCCCATGCTCAGGTTGTGCAGTGTGGAAGCTTTTCCTATTGTTGCCATAAC
AAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTATTTAATTATCTTACAGTGCTCTAGCTCAAAGCATGAAGTGC
ATCTCACTGGGCTAAAATCAAGATGACAGCAAGCCTGCCTTCCCTCTGAGGATTCCAGGCAAGAATCTGCTTCTCACTTG
TCCCATCTTATAAAGGCTCCCAGTTCCTTGGCTGCTGGTCCCCTTCCTCCTTCCTCAAAGCCCACAAAGGCTGGTCACAT
CTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACCTCTTTCTCTGAATGCTGCTCTCCCTTCTTCCTCATCTTTT
GAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCGTCATAATCTCCCGGAAATCATTCAGGATACCCTTGTT
TTAAGTTCAGCTGATTAGCAACCGTAATTCCATCTGCAATCTTCATTCCTCCTTTCCATGTAAAATAACATATTCACAAG
CTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGCATTCTCCTGCCTTCCACAAATGGTGAACAAGATGCATTTG
GCCTCTGCTCTTGGGACACTGATATTGCAGATGGTTAAATGGGAGGACAGAAAATGAATGCACAAGTGGACCAATAAATG
AATGATCCATTGGGAAGCATCTGTGCATGAAATCTATTTGTTTGTTTGTTCGTTTGTTTATTGAGACAGAGTCTCCCTCT
GTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCACTGCAACCTGCATCTCCTGGATCCAAGTGATTCTCCTGCCT
CACCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCATGCCCGGCTAATTCTTTTTGTATATTTTTTGTAGAGAGGA
TGTTTCACCATGTTGGCCAAGCTTGTCTGAAACTCCCAACCTCAAGTGATCCAACCGTCTCAGCATCCCAAAGTACTGGG
ATAAAAGGCGTGAGCCACTTTGCCCAGCCAGAATTCAAAATAAATAATAGATAATGCTGAGTGTATAATTTTGGGTGACA
GAGAAGGTCTCACTAATCAGATATTTGTGACATTAATGAAAAACACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTT
TCCACACACAGCTGTCAGCCGTGAAGGCAGAAAGCTGAAAACAATCTGATGTGGAAGGAAGAGGCTCTGCCTGAAATGCT
GGGAATGAGATGGGGAGAATGACAAGACGACTGTAGAGAGACGGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAAC
AAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACCTCGGGGTAACCAGGAATCCCTACATGATTAATATGACTGA
CATGAAAATAAGGGAGGCTCAGGTGCGTAACTGGAATCTAGGAGACCGTGGAAAAGGCAATTGCCGCCCCACTGGTGAAA
TGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGATGGATATAAGATATGCTTGTGAGGTAGAATCATTGACTGGAAA
GGCTTACTGGGTTTGATTTTCCTACTTGTTTAATCCTCGCTTAATTAATTTCTTTCTGAGATTTATTCATCCTACACATA
AATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGGTGGTGGAAATGAAGGGACCTATCATAGCATAATATACAAGT
CTGTGAACGGTGGCTCATGCTTGTAACCCAGCACTGCAGGAGGCCAAGGCGGGTGGATTCCATGAAGTCAGGAGTTCCAG
ACCAGCCTGGCCAACATGGTGAAACCCTATCTGTACTAAAAATACAAAAATTAGCCGAGCATGGTGGTGCATCCCTGTAA
TCCCAGCTCCTACTCTGGAGGATGAAGCAGGAGAATGACTTCAACCCAGGAGGTGGAGGTTGCAGTGAGTGGAGATTGCA
TCACTGCACTCCAGCCTGGGGTGACACAAGGAGACTCCGTCTCAAAAAATAAAAATAAGAAATGCATAAATATAATAAAA
CACACACGAATGACAAAGGCACCTGAATTCCAATCATCATTTTTCTATTTCTCTATAATTACTTCTTTGATCCTTTATCT
TATCCATTAGGCAATGAGCCTAAAACCTCTTCCCTATTTGGCTTTCTGTGAGCATGAGATCACATAGAAAATGTGAAAGC
CCGCTGAATCCTCCAGCACGGATCCTGGAATAGAGAAAGTGCTCTGGTCATCGCAAAAAAAAACTTGCCCACTCACCCAA
ATCCCCCACCTCACCCCTACTTCCAATCACCTGTGGAGATTCAGATAGACCATGGGGAGGAAACATTAATACTCCTTGGA
GTGAGTCCAGATCTTGGAATCAGAGATCAGCGACAGCACTAGCTCCTGTTCCCCTTTCCTACTAATTCACAGGAGGACAG
GTGGTATTGAAGCAATAGATGGTCGAGGGGGTGGTCCTTCCCCCAGCCTCTCGGGTAGAACAGCAACCTAACATGTGTCT
CCCGAGATCACAAAGAGTAGCACATTTCACACGGGCTTCAACACTATTTCCTGGCTGTTTGACATAAGAGAATCTTGCTT
CGCTATTTTTAATCGTGATGTCACCTTTGTTTCCTTTCCTTGGTGAATGCAATTTGTTTGACTCAAGAATGCTGTGGATG
TAGAAATCCTAAAGCACATTCGCTGTGTATCAATCCCAGTGCAGTCTTCCCAGAGAAGACTCTAAACAAATCCTGGACTG
CACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAATACGTTACATAGGCAG
GTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTGCATTTCAATGTGAGCCAGTCCCTCAAGGCTCAGAAAA
GCTGCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAGCTGGGGGAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTAC
CCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGT
TCTGAGACATTCCTCCTGATCTCAGGATGTTGCTATCTTAGTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGGGT
AACTTCTAAAGAAAAGAGATTGGTTTGCCTCACAGTTCTGCAGGCTGTACTGGAAGCATGGCACCAGAATCTATTTCTCG
TGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCGCAGAGATCACACGGCAA
GAGAGAGAGTAAGGGGGAGAGGGAGCGATGGAGCTTCCAAGCTCTTTTTAACAACCAGCTCTCCAGGAACTAACAGAGGG
GGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGATCTGTTCATGATGGATCCACCTCCATGACCCAAACACCTCTGA
AGAGGCCCAACCTCCCACAATGGGGGGTGAAATTTCAATGTGAGGTTTGAAAGGGTCAAACATCTCAACTAAAGTAGTTG
TATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAATTGAGAAAGCAGGGGAAAGCTAGGTCTCCCGCCATTTGGGT
GCTTGTCCTAAAGAGACGTTGTATGTGGTTACCTGCCAATCAAGAAATGCGAGACAATTCATAAAGAGGAACTGCTATGA
TTAGCTTCTTATTGGTGTCTCCTCTTCTTCCAGGTAACCCCAGACACCTACATGTTCTGATTGGGACCTCAGTGGTCAAA
ATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCTCCGACAAAAAAAGTAAGTCTCACGAAGCAGAGGC
CAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCACGTGGATGTGTGTTCCTCACCAGCAGGATGGTCCCTGGCC
CAAGACAGGAGCCACAGAGGCAGGACTTTCTAGAGAGAGCACCAGATTCCCTTCCCCTGCCTTCAGCTCACAGACCATTG
CCTGATTCTGAACTGTATCCTCACGTCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGA
GATAGAATCAATGGGATGGGACCTCAGAGCTATTCATGGGATGGGTCCTTGAACTCAGAGAGATAGAATGTCTGAGTCTG
CTGTTGGCAACTGAGGGACCTCAGGCACCTATGGCCTCCCCCTGTTTGTTGGTATCTGCTTATGAAATGAGGACCCAGAA
GTGCCCTCCGAGCTCTTTTGTTGACTTCCGTCTTCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAAC
AGTGAACAGCGAGGTAGGTGCTCCTCGGCCCAGCCTCGTGGCTAGTCTTATTCCCAAAGAGTCCTGAAAAATGTGAGCAC
CCTCCCTCACTCAGCATTTCCCTCTCTCCAGGATTCTGATGAACAAGACCATCAGGAGGTGTCATACGCATAATTGGATC
ACTGTGTTTTCACACAGAGAAAAATCACTCGCCCTTCTGAGAGGCCCAAGACACCCCCAACAGATACCAGCATGTACATA
GAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTTCTGTCCACGAGCACCACAGTCAGGCCTTGAGGGGATCTTCTA
GGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATGTACCAGCAGCTGGAATCTGAAGGCATCAGTCTTCA
TCTTAGGGCATCGCTCTTCCTCACACCACGAATCTGAACATGCCTCTCTCTTGCTTACAAATGTCTAAGGTCCCCACTGC
CTGCTGGAGAGAAAACACACTCCTTTGCTTAGCCCACAATTCTCCATTTCACTTGACCCCTGCCCACCTCTCCAACCTAA
CTGGCTTACTTCCTAGTCTACCTGAGGCTGCAATCACACTGAGGAACTCACAATTCCAAACATACAAGAGGCTGCCTCTT
AACACAGCACTTAGACACGTGCTGTTCCACCTCCCTTCAGACTATCTTTCAGCCTTCTGCCAGCAGTAAAACTTATAAAT
TTTTTAAATAATTTCAATGTAGTTTTCCCGCCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR