Allele Report for 2DS4*0060101


2DS4*0060101
Previous Designations & Local Names: B193(v1)
IPD Acc No: KIR00090
Assigned: 28-JUN-2003 Sequence Last Modified: 18-JAN-2008
Source Entries: AJ620616 , EU143324 , GU182343  
Cells Sequence Derived From: B193 , FH08 , RDP17  
Known Ethnic Origin Of Source: Black
Publications
Maxwell LD et al. Hum Immunol 65:613-21 2004. abstract
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
Protein Sequence (233 aa)
MACVGFFLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHREGKFNNTLHLIGEHHDGVSKANFSI
GPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDMVIIGLYEKPSLSAQPGPTVQAGENVTLSCSSIYPGRGRPMNVGSLQC
AASTEHSRPTFLWALPPTEGPTDASALSVTLPTSGQTRVIHCLFPSQETLQIVGLHPLNQAPKPVTPDTYMFX
Nucleotide Sequence Data (850 bps)
CATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACAGGAGGGAGTCCACAGAAAACCTTCCTTCCTGGCCC
TCCCAGGTCACCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCGGATGTCATGTTTGAGCACTTCCTTCTG
CACAGAGAGGGGAAGTTTAACAACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTTTCCAAGGCCAACTTCTCCAT
TGGTCCCATGATGCCTGTCCTTGCAGGAACCTACAGATGCTACGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTC
CCAGTGACCCTCTGGACATGGTGATCATAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAG
GCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCATCTATCCAGGGAGGGGGAGGCCCATGAACGTAGGCTCCCTGCAGTG
CGCAGCATCAACGGAACATTCCAGGCCGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTC
TTTCCGTGACGCTCCCTACGAGTGGTCAAACTCGAGTGATCCACTGCTTGTTTCCGTCACAGGAAACCCTTCAAATAGTT
GGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTAACCCCAGACACCTACATGTTCTGATTGGGACCTCAGTGGTCAAA
ATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCTCCGACAAAAAAAATGCTGCTGTAATGGACCAAGA
GCCTGCAGGGAACAGAACAGTGAACAGCGAGGATTCTGATGAACAAGACC
Genomic Sequence Data (15833 bps)
GTTTGGGAGGTTGGATCTAAGACGTGTTTTGAGTTGGTCATAGTGAAGGACGCGAGGTGTCAATTCTAGTGAGAGCAATT
TCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACACACTGGGCCTCATGCAAGGTAGAAAAAGCCTGCGTACGTCACCCT
CCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCG
CGGCCGCCTGTCTGCACCGGCAGCACCCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAATAGAGGGAGGGAGCGTGGGGA
TGGAGATCTGGGCCCAGAGGTGGAGATATGGGCCTGGAGGTGGAGTTATGGGCCTGGAGTGGAGATCTGGGCCTGGAGTG
GAGATCTGGGCCTAGAGATGGAGTGATGGGCCTAGAAGTGGAGATCTGCGCCTGGAGTGGAGATCTGGGCCTGGAGTGAA
GATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGGGATAGGAACCTGGAGTGGAGAGAGGAACCTGGAGGAGAGATA
GGAACCTGGAGGGGAGGTAGGAGCCTAGGGTGGAGATATGGGACTGGAGTGGAGATATGGGACTGGAGTGGAGATATGGG
CCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGATATGAGCCT
GGAGTGGAGATATGGTCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGCAGTGGAGATATGGGCCTGGAG
GTGGAGATATGGGTCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTG
GAGATATGGGACTAGAGTGGAGATAGGGGCCTGGAGGTGGAGATCTGGGCCTGGAGTGGAGATGTGGGCCTGGAGTGGAG
ATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGCAGTGGAGATATGGGCCTGGAGGTGGAGATA
TGGGCCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGATATGG
GACTAGAGTGGAGATACGGGCCTGGAGGTGGAGATCTGGGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATATGGGCC
TGGAGTGGAGATATGAGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGAGCCTGGA
GTGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGGAGTGG
AGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGGTGGTGATATGGGCCTGGAGTGTAG
ATATGGGCCGAGTGGAGATATGGGTCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGACTGGAGTGGAGATATAG
GCATGGGGTGGAGACATGGGCCGGGAGTGGAGATATGGGACTGGAGTGGAGATACGGACGTGGGGTGGAGATATGTGCCT
GGAGGTGGAGATATGGGCGTGGGTTGGAGATATGGGCCTGGAGTGGAGATATGGGCGTGGGGTGGAGATATGGGTCTGGA
GTGGAGACATGGGCATGGGGTGGAGATATGGGCCTGGTGTGTAGATATGGGCCTGGAGTGGAGATATGGCCCTGGAGTGG
AGATATGGGCCTGGAGTGGAGATCTGGGCCTACGGTGGAGATATGGGCCTAGGATGGGGATATGGGCCTGGAATGGAGAT
ATGGGCCTGGGTGTGGAGATATGGGACTGGAGTGGAGATATGGGCCTGATGTGGAGATATGGGCTTGGAGTGGAGATATG
ATCCTGGAGTGTAGTTATGGGCCTGGAGGTGGAGATCTGGGCCTGGGGTGGAGATATGGGCCTGGAGTGGAGATATGGGA
CTGGAGAGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGATTGGAGATATGGGCCTAGGGTGGAGATCTGAGCCTGG
ATTGGAGATGTGGGCCCGGATTGGCTATATGGGTCTAGGGTGGAAATATCGGCCTGGAGTGGAGATATGGGCCTGGAGTG
GAGATATGGGCTTGGGGTGGGGATATGGGCCTGGAGGCTGGGTCTCTGCACAGCCGAGAGCACTGTTCTTGGGTGCAGGT
AGGCACTGATGGTGAGTTTCCCTTCGGCCCAGGAAGGGGCTGGCTATCAAGACTCACAGCCCAGTGGGGGCAGCAAGGAA
GGCCTTGTTTGCCTGCAAATGGATCTTCCATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACA
GGAGGGTAAGTCCTTCTCCAAACCTTAGGGTGTCATCTCCCCACATAAGAGGATTTTCCTGAAATGGGAGGGAAGTCCTG
TCAGGGAGTCTCTCATAAACTAGGAAGAGGGGACCCTGGGGTGCTCGGCCCACAGTTCCGACCTTGCCTCCCTGGCCTCT
CAACCCCTTGGCAGAGTCAAGTTGTGTGGGGACCAGGGTTGGACTAGGGTGTTCAAAGCTGGGTTGTGTGGTGGGGAAGT
GGTAGGAACAGCAGATCCTCTGAGGACAAAGGTGTTACTCACACACTTCAGCGTTTCCATGACGGTAGGGGCTGCAGTGT
GGCTGCTGTCATTCTACCAGAAGAGGTGGGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGATGGGGGCTAAGT
TTTTTATTCTCATTCAGGCAACTGCTGATATTCCATTCTCAAAGGACATGCCCTCCACTTCATGTCTACCCTGTGTTGTT
TTATGTCAGTAATCTTACAGTATTAAAATCTAGTAGGAGTCTCTTACTCAGCACTTGCTCAAAGTTCTCAGCTGACACTT
TTGTTGTACGGAGACACCTTGTCTTTGTGGGATGGGTCCTTCCTTTAGCCCTAGGCACCAAGGTGTGATAGCAGCCATAG
AAATGTGGAAAGTGGGGAGAATCTTCTGAGCACAGGGAGGGAGGCACAGCTCCACATCCTCCTCTCTAAGGCGGCGCCTC
CTTCACCCCAAGGTGGTCAGGACAAGCCCTTGCTTTCTACCTGGCCCAGCCTTGTGGTGCCTCCAGAACATGTGACTCTT
CAGTGTCACTCTAATCTTGGGTTTAACAACTTCAGTCTGTACAAGGATGATGGGGTGCCTGTCCCTGAGCTGTACAACAG
AATATTCTGGAAAAGCCTTTTCATGGGCCCTGTGACCCCGTCACATGCAGGGACCTATAGATGCCGGGGTTCACACACAC
ACTCCCCCAGTGGGTGGTCGGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGTCAGAGGGCTCCTGTCTGGGATTCT
CCTTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTAGGCATGTCCTTGAGGGTCCCATCACGCAGGCCCTAACTGTATTT
GGGGTAAAGGGGGATTGAATACAGGGAAATGGGTGCTGTGGTGGGAAGAATAAGTGTCCCCAATGATGACTGCATTCTAA
TCCCTGGAGTCTGTGACTATTTATGTTATAGGGGAAGGGACTGAAGGGGAAGATGGAGCTCAGGTTGTTGATGAGTTGAC
CTTGAGATGGGGAGACAGCCTGGACTGTCCCGGTGGGCTCAGTATAATCACAAGTGTCCACATGAAAGGAGGAGGAAGAG
GAGAGTGGGGATTAGAGCAGCGTAGTGGGAGACTCCATCAGCTTTGAAGGTGGATGAAGGCCATAAGCCATGAATGCAGG
TGGCCTATAGAGGCTGGGAAAGTCAAGTAACTGATTCTCCTGAGTCTCCAGAGGGAACACAGCCCTGCAGATGCCTTGAT
TTTAGCCCTCGAAAAACAGGGTCCGCTTTCTGTCTCCAGAATCGGAGGGGGTCAGTGTGCTCTCTCCTGCTGCCATGCTT
CTGATAATTTTCTACAGCAGCAACAGGAAACCAACACTGGAACCCAGGTCAAGGACAAGTTAAGAAAAGACACAAGGATA
GCCAGGCATGGTGGCAGGTGCATGTAATCCTAGCGACTCAGGAGGCTGAGAGCAGGAGAATCGCTTGAACCCAGGAGACA
GAGGTTGCAGTGAGCGTAGACCACACCACTTCACTCCAGCCTGGGCGAAGGAGTGAGACTCTGTCTCCAAAATTAATTAA
TTAATTAAAGAAACCAAACAAAGAGAAGGTTGGCTACACCGAGATCAGCAAGGGTGGGATGATGATGCCACCACCAGGCT
CCATCCACATAGGGAGGGGTTGATACTCCTCAAATCAGCACGAGGAGCCAGCCTATGGAAACTGGCACCATGGAGAAGGC
ACAGACATGGCAAGAGTGGCTCCCAGTCCCCACCAGGAACAGGGTGTGTGGACACTGGTGCCTGCCTTACTGATCAGTTC
ATACCTCCTGCCAAGGATTCCAATTCGTCCAAAAGAGATTGAACCAGGCTGCTAAGAGCCGGGACGTGCAGCCTATCCTG
CTTCCTCTTCCACTCCCACATAGACAGTAAGAAAGACATTAGTGTGAAATAGATACAACAGCCCAAGAGATGAGGCTGAG
CCCAGTGGGAAGGGAACCACAGCTACTAGAGACAGAGGGACAGAGAAGAGGGAGGGAGACAGATGGAAGGACCTGCACCA
GGAGTTATGGGCACAGAAAAGAACATGAAGACACAGAGAGGAAGCAGAGAGACAGACACCAGCGAAGGGAAGGCTCACTC
ATTCCAGGTGCCATGGATGGGATGATAAAGAGAGACACCTTCTAAACTCACAACCTCTCTTCCTAGGAGTCCACAGAAAA
CCTTCCTTCCTGGCCCTCCCAGGTCACCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCGGATGTCATGTT
TGAGCACTTCCTTCTGCACAGAGAGGGGAAGTTTAACAACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTTTCCA
AGGCCAACTTCTCCATTGGTCCCATGATGCCTGTCCTTGCAGGAACCTACAGATGCTACGGTTCTGTTCCTCACTCCCCC
TATCAGTTGTCAGCTCCCAGTGACCCTCTGGACATGGTGATCATAGGTGAGAGTGTCCAGACATTCTTCTCATTGTCATT
GGGATGCAGAGTGAATGATCCAGGACTTGGAGACCCAGGTGGTTGTAAGGAAGATGAGCTTGGTATTCTTATGGAGAGAG
ACTGACTTGGTGAGGTCTGTGCCAACAGAGACAGAGAAACAAGAGACACAAGTACAGACCAGGTGTCGTAACAGAGGACA
AACACAGGGGCCATACAGGGAGTTAGAAAAGACAGAAAGAGTTAAAGGAGACAGACAGACATGTCCCAGACAGAGGTGTC
CTTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTGTTCTCTAC
CAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCACCTACAGATGCCA
TGCTTATTCTGACACCTCTGACTTCCATGCAATGGAGAATAATCGTCCCAAAATATCATGGCCCCAGAACACCAACCCCT
GTATGCTGTGTGAACTTGTGGTCTCCAGACTGGATTCTGAGGCTCACATTCCAAATAACCCCACATATCACATATGAGAG
GATCACTGAGAAGCACAGAGAGAAATCAGGGACACCAAAAAGCAAAGACATAAACACACAGAGAAAGAGCCAGAGGAAGG
AGATTGAGAGACTCACAGACACATAAAGAGAGAGAAGAGGGCAGAGAAGTGGAGAGAATGATGGAAGAGAGCAGAGAAAA
CCACTAAAATTAGAGTCCTGAGGGTGAGGCACAAGGGCATAGAAAGATGGAGATGTGGGGATGAATTGCAGAGATTCCAA
AGAGAACTAGAGAGACCGAGAGGCAGAGCAAGACAGATGATAGATGGATAGATACAGATAGATGATGGATAGATATAGAT
AGATGATATATAGGTAGATGATAGATAATAGGTTATAGATACATAGATGATGATTGATTGATTCATTAATAGATGATACA
TAGAGATGATGATGATGAAGATAGATGGATAGATAATACATAGAGATAGAGAGGAAGACAAAGAGAGAAATAATAGAGAG
AGAGAGATGATACATATATATAGATAATAGATGATTGACGGATAGACAATTGATAGATAAATAGATGATATATAGATATA
GATGACAGGTAGAGAATTTGTAGATAGGCACCGAATAGATAAATAGATGGATTGATAGATAATAGATAGAAATATGCAGA
AAGTTATGAACGGGACACAAACTGAGAAACTCAGAGTTAAAAAAAGTAACATCAAGTCAACCAATCCAAGGAGAGCCAGA
GAGAATAAAACAATCCAAAAACGGAAAACATAACTAGAGGTAGGGAAGTGAGGTCAGAGACCTACAGAGACAGAGAAGGT
GGAAGGAGGAAATAGACATGAAGAGAGATGGGGTGGAGGGTGAGACAGAGAAAGAGAGCATTAGGCCATAGAGCAGGGGA
GTGAGTTCTCAGGTCAGGTGTGAGGGGAGCTGTGACAAGGAAGATCCCCCCTGAGGAAACTGCCCCTTCTCCTTCCAGGT
CTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTC
CATCTATCCAGGGAGGGGGAGGCCCATGAACGTAGGCTCCCTGCAGTGCGCAGCATCAACGGAACATTCCAGGCCGACTT
TCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGACGCTCCCTACGAGTGGTCAAACT
CGAGTGATCCACTGCTTGTTTCCGTCACAGGTGAGGAAACCCCATATCTGTCCCATGTCCTATGATCCTAGAGCCTTAGC
TGAGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGACAGATGCAGAGAGAAGACGCAGCATGCCTGTAAGGGAGGGATC
AGGGCGCAGGATGGCACACACAGCACCTCCAAACCCTCCTGCATGGCCTGCATGGAGGCCTCCGATTAGGGCTCCAGGCA
CCCAGGCAGATGTAGAAAGCGGTCAGGAGAGACCCAGAGAAGGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGTTCCC
TCAGCCCCTCAACCTTACCCATTTCCCAGAAGCCCTTCCTGGCCTCTCACCCACACAGAGATGTCATCACCAGCAACCCC
TACATCCTTTTCTTTTTGTTTGAAAAAATATTTATTGAGGTTAAATATACCTATATAGCTTACCACTTTTAACATTTTTT
TTTTTTGAGGTGGAGTCTAGCTCTGTCTCCTATGCTGGAATGCAGTGGCACAATCTCAGCTCACTGTAACCTCCGCCTCC
TGGGTTCAAGCGATTCTCCTGCCTCAGCCACCTGAGTAGCTGGTACTACAGGCGCCCATCACCACGCCAGGCTACTTTTT
GTATTTTTAGTAGAGAGGGGGTTTCACCATGTTGGTCGAGCTGCTCTGGAACTCCTGACCACGTGATCCACCCGCCTCAG
GCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCGCGCCCGGCCACGTTTACCAATTTTAAGTGTAAGGTCTAGTGGT
CATAAATACATACATATAAATTTTTTGTTTGTTTGTTTTATCCTCCACCCTTTTCTTCCTGGCCTCTGGTAGCCACCATT
CTACTCTCTATCTTCATGAGATCCACCTTTTAGCTCCTGTATATGGGTGAGAAATGAGAATATTTGTAATGACTTCCAGT
TCCATCCATGTGGCTGCAAATATCAGGATGTTATTCTTTCTATGGATGAGTAGTCTCCGCTGTGCGTATGTACTACATTC
TCTCTATCCATTCATCCACTGATGGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAAGAGTGCTGCACCAATCATA
CGAGTGCAGATATCACTTCGATACATTGATTTACTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGATACTATGA
AAGTTCTCTTTTTAGTTTTTCGTTTGTTGTTTTGTTTTTGTTTTTGAGACAGTTTCCCTCTGTGCCCAGGCTGGAGTACA
AGTGATGTGATCTTGGCTCATTGCAACCTCCGCCTCCTGGGTTCAAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCTGG
GATTACAGGTGCACGCCACCATGCCGGGATACTTTTTGGTTTTTTTTAGTGTACATGGGGTTTCCCCAGGTTGGCTAGGC
TGCTCTCAAACTCATGACCTCAACTGAGGTGCCCGCCTCGGTCTCCCAAAGTGCCGGGATTACAGGCATGATCCACTTCA
TCCAACCTCTTTTTAGTTCTTTAAAGGACTTCCATACTTTTCTCCGTAATGGCTGTACTAATTTACACTCCTACCAACAG
GGTACCAGGGTTCTCCTTTCTCTACCACCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTTAT
TTCATTTTATTTTGAGATGGAGTTTCGCTCTTGTCACCCAGGCTGGAGTGCAGTGGTGCGATCTCGGCTCACCGCAACCT
CCACCTCCCAGGTTCAAGCGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGAATTACAGGCACACGCCACCACGCCCGAC
TAATTTTTGTATTTTTAGTAGAGACAGCGTTTCTCCATGTGGGTCATACTGGTCTCAAACTCCCGACCTTATGAGATTCG
CCCACCTCGGGCTCTCAGAGTTCTAGGATGACAGACGTGAGCCACCTCGCCCGGCCTAAAAGCCATTTTAATGGGGTGAG
ATGAAAACTCACTTTGATTTTAATTCGCGTTTCTCTGATGATGAGTGATACTGAGCACTTTTTCGTATGTGGGGAAATTT
CATGTCTTTTGCTCCTTTTTCAATTAAATCATTTGTTTTATTGAGTTGTTTGAGCTTCTTATACTTCTAGTTACTAATCC
CGTCTCAGAAGCATAGTTTGCACATATTTGCTCCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCGGT
GCAGAAGTTGCTTAGTTTGAGGTAATCCCAATGGTCTATTTTTGCTTCAATTACTTGTGTTTTGAAGGTTTAAAACAAAA
TGTCTTCCTTCAGACAAATGTCCTGGAGCATTTCCCCAATATTTTCTTCTACGTGTTTCACAGGTTCAGGCCTTAGACTC
ACATCTTTAATCCACTTTCATTTGATTTTTGTGTATGGTGACAGGTAGAGGTGCAGTTTCATTCCTCTGCATGTAGATGT
CCAGGTTTCCCTGCACTGTTTATTGAAAAAACTGTCCTTTCCTGATTGTGAGTTCTTGGCACCTTTGTCAAAGTCCATTG
GATGGGCTGGGCATGGTGGCTAACACCAGCAACTTCAGCACTTTGGGAGGCCAAGGCTGGTGGATCACCTGAGGACAGGA
GTACAAGATTACTCTGGCCGACGTGATGAAACATCGTCTCCACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCA
CCTGTAATACTACTACTCAGGAGTTTGAGGCAAGAGAATTGATTGAACCCAGGAGGCTGAGGTTGCAGTGAACCGAGATT
GCACCTCTGCACTCCAGCCTGGGTGACAGAGCGAGACTCCATCTCAAAAGAAAAAATAAAAAAAATTGGATGTAAATGCA
TGGATTATATCTGTGTTCTTCATTCTGCTCCGTTGTTCTATGTGCCTTTCTTCATGCCAACATCATGCTGTTTTGCTTAC
TACAGCTCTGTAACATATTTTGAGATCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTGAAGTCTCAAGACAGTG
GGCGTCACATACAAAAATTATGGAAGAAAGGATCCCTGGACTCCCAGGGCCCAATGTTAGATAACAGAGTGTTGGCCATG
AACCATCCTCAAAGATTTCCATTGAGTAGAGGACAGACACCCGCATTTCCTCACCTCTCTCCTGTCTCATGTTCTAGGAA
ACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTGAGTACAGGACCCTCTTATATCTGCTTTTG
GAACCCTGGGGAGGTGGAAACCTTGGATTCAGGCGTTGACTCAGCATCTCACAGCTCTGACATTGTACGCCTGTCTTCTA
CCATCTCCGAACTCCAGATACTCCAACAGCGAAAGGGATCTGGGCCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTC
ATTTTATGGAGCTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAATGTTT
GTTCTGCTTGCATTCCTAACTGGAGGATAAATTCCTGGGGGCTTGAGAGAGGGAAGGGAAGCGAACATCTGATGAGGGCG
AGGTGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAGCTCCTGTTGGTCATGAAACAACCCTGGCTGACTCAGCAGAGCA
AGAGCCTTGCCGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTTATTCAGCCATGGCCCCATGCTC
AGGTTGTGCAGTGTGGAAGCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTA
TTTAATTATCTTACAGTGCTCTAGCTCAAAGCATGAAGTGCATCTCACTGGGCTAAAATCAAGATGACAGCAAGCCTGCC
TTCCCTCTGAGGATTCCAGGCAAGAATCTGCTTCTCACTTGTCCCATCTTATAAAGGCTCCCAGTTCCTTGGCTGCTGGT
CCCCTTCCTCCTTCCTCAAAGCCCACAAAGGCTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACAC
CTCTTTCTCTGAATGCTGCTCTCCCTTCTTCCTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAA
TCCGTCATAATCTCCCGGAAATCATTCAGGATACCCTTGTTTTAAGTTCAGCTGATTAGCAACCGTAATTCCATCTGCAA
TCTTCATTCCTCCTTTCCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAG
CATTCTCCTGCCTTCCACAAATGGTGAACAAGATGCATTTGGCCTCTGCTCTTGGGACACTGATATTGCAGATGGTTAAA
TGGGAGGACAGAAAATGAATGCACAAGTGGACCAATAAATGAATGATCCATTGGGAAGCATCTGTGCATGAAATCTATTT
GTTTGTTTGTTCGTTTGTTTATTGAGACAGAGTCTCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCA
CTGCAACCTGCGTCTCCTGGATCCAAGTGATTCTCCTGCCTCACCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACC
ATGCCCGGCTAATTCTTTTTGTATATTTTTTGTAGAGAGGATGTTTCACCATGTTGGCCAAGCTTGTCTGAAACTCCCAA
CCTCAAGTGATCCAACCGTCTCAGCATCCCAAAGTACTGGGATAAAAGGCGTGAGCCACTTTGCCCAGCCAGAATTCAAA
ATAAATAATAGATAATGCTGAGTGTATAATTTTGGGTGACAGAGAAGGTCTCACTAATCAGATATTTGTGACATTAATGA
AAAACACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTTTCCACACACAGCTGTCAGCCGTGAAGGCAGAAAGCTGAA
AACAATCTGATGTGGAAGGAAGAGGCTCTGCCTGAAATGCTGGGAATGAGATGGGGAGAATGACAAGACGACTGTAGAGA
GACGGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCAC
CTCGGGGTAACCAGGAATCCCTACATGATTAATATGACTGACATGAAAATAAGGGAGGCTCAGGTGCGTAACTGGAATCT
AGGAGACCGTGGAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGATG
GATATAAGATATGCTTGTGAGGTAGAATCATTGACTGGAAAGGCTTACTGGGTTTGATTTTCCTACTTGTTTAATCCTCG
CTTAATTAATTTCTTTCTGAGATTTATTCATCCTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGG
TGGTGGAAATGAAGGGACCTATTATAGCATAATATACAAGTCTGTGAACGGTGGCTCATGCTTGTAACCCAGCACTGCAG
GAGGCCAAGGCGGGTGGATTCCATGAAGTCAGGAGTTCCAGACCAGCCTGGCCAACATGGTGAAACCCTATCTGTACTAA
AAATACAAAAATTAGCCGAGCATGGTGGTGCATCCCTGTAATCCCAGCTCCTACTCTGGAGGATGAAGCAGGAGAATGAC
TTCAACCCAGGAGGTGGAGGTTGCAGTGAGTGGAGATTGCATCACTGCACTCCAGCCTGGGTGACACAAGGAGACTCCGT
CTCAAAAAATAAAAATAAGAAATGCATAAATATAATAAAACACACACGAATGACAAAGGCACCTGAATTCCAATCATCAT
TTTTCTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATGAGCCTAAAACCTCTTCCCTATTTG
GCTTTCTGTGAGCATGAGATCACATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCACGGATCCTGGAATAGAGAAAGT
GCTCTGGTCATCGCAAAAAAAAACTTGCCCACTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCACCTGTGGAGAT
TCAGATAGACCATGGGGAGGAAACATTAATACTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATCAGCGACAGCACT
AGCTCCTGTTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTATTGAAGCAATAGATGGTCGAGGGGGTGGTCCTTC
CCCCAGCCTCTCGGGTAGAACAGCAACCTAACATGTGTCTCCCGAGATCACAAAGAGTAGCACATTTCACACGGGCTTCA
ACACTATTTCCTGGCTGTTTGACATAAGAGAATCTTGCTTCGCTATTTTTAATCGTGATGTCACCTTTGTTTCCTTTCCT
TGGTGAATGCAATTTGTTTGACTCAAGAATGCTGTGGATGTAGAAATCCTAAAGCACATTCGCTGTGTATCAATCCCAGT
GCAGTCTTCCCAGAGAAGACTCTAAACAAATCCTGGACTGCACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTC
CAGGGAGACAGAACACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGC
CTGCATTTCAATGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTGCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAG
CTGGGGGAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGA
CGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGAGACATTCCTCCTGATCTCAGGATGTTGCTATCTTA
GTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGGGTAACTTCTAAAGAAAAGAGATTGGTTTGCCTCACAGTTCTG
CAGGCTGTACTGGAAGCATGGCACCAGAATCTATTTCTCGTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGG
AGGGTCTGTCTGTGCAGAGACCGCAGAGATCACACGGCAAGAGAGAGAGTAAGGGGGAGAGGGAGCGATGGAGCTTCCAA
GCTCTTTTTAACAACCAGCTCTCCAGGAACTAACAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGATCT
GTTCATGATGGATCCACCTCCATGACCCAAACACCTCTGAAGAGGCCCAACCTCCCACAATGGGGGTGAAATTTCAATGT
GAGGTTTGAAAGGGTCAAACATCTCAACTAAAGTAGTTGTATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAATT
GAGAAAGCAGGGGAAAGCTAGGTCTCCCGCCATTTGGGTGCTTGTCCTAAAGAGACGTTGTATGTGGTTACCTGCCAATC
AAGAAATGCGAGACAATTCATAAAGAGGAACTGCTATGATTAGCTTCTTATTGGTGTCTCCTCTTCTTCCAGGTAACCCC
AGACACCTACATGTTCTGATTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTG
GTGCTCCGACAAAAAAAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCAC
GCGGATGTGTGTTCCTCACCAGCAGGATGGTCCCTGGCCCAAGACAGGAGCCACAGAGGCAGGACTTTCTAGAGAGAGCA
CCAGATTCCCTTCCCCTGCCTTCAGCTCACAGACCATTGCCTGATTCTGAACTGTATCCTCACGTCCCCTGCAGCCACTC
ACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGAGATAGAATCAATGGGATGGGACCTCAGAGCTATTCATGGGA
TGGGTCCTTGAACTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGGCACCTATGGCCTCCCC
CTGTTTGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTCTTTTGTTGACTTCCGTCTTCTACAGA
TGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGTAGGTGCTCCTCGGCCCAGCCTCGTGG
CTAGTCTTATTCCCAAAGAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGATTCTGATG
AACAAGACCTTGGATCACTGTGTTTTCACACAGAGAAAAATCACTCGCCCTTCTGAGAGGCCCAAGACACCCCCAACAGA
TACCAGCATGTACATAGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTTCTGTCCACGAGCACCACAGTCAGGCC
TTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATGTACCAGCAGCTGGAATCTG
AAGGCATCAGTCTTCATCTTAGGGCATCGCTCTTCCTCACACCACGAATCTGAACATGCCTCTCTCTTGCTTACAAATGT
CTAAGGTCCCCACTGCCTGCTGGAGAGAAAACACACTCCTTTGCTTAGCCCACAATTCTCCATTTCACTTGACCCCTGCC
CACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTACCTGAGGCTGCAATCACACTGAGGAACTCACAATTCCAAACATA
CAAGAGGCTGCCTCTTAACACAGCACTTAGACACGTGCTGTTCCACCTCCCTTCAGACTATCTTTCAGCCTTCTGCCAGC
AGTAAAACTTATAAATTTTTTAAATAATTTCAATGTAGTTTTCCCGCCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR