Allele Report for 2DS4*0040101


2DS4*0040101
Previous Designations & Local Names: 2DS4-RaT
IPD Acc No: KIR00089
Assigned: 28-JUN-2003 Sequence Last Modified: 11-SEP-2005
Source Entries: AJ620615 , AY366246 , EU143322 , GU182349  
Cells Sequence Derived From: B160 , G085 , RDP14 , RaT  
Known Ethnic Origin Of Source: Caucasoid
Publications
Maxwell LD et al. Hum Immunol 65:613-21 2004. abstract
Artavanis-Tsakonas K et al. J Immunol 171:5396-405 2003. abstract
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 4 Laboratories: 4
Protein Sequence (240 aa)
MSLMVIIMACVGFFLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHREGKFNNTLHLIGEHHDGV
SKANFSIGPMMPVLAGTYRCYSSVPHSPYQLSAPSDPLDMVIIGLYEKPSLSAQPGPTVQAGENVSLSCSSIYPGRGRPM
NVGSLQCAASTEHSRPTFLWALPPTEGPTDASALSVTLPTSGQTRVIHCLFPSQETLQIVGLHPLNQAPKPVTPDTYMFX
Nucleotide Sequence Data (871 bps)
ATGTCGCTCATGGTCATCATCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACAGGAGGGAGTCCACAG
AAAACCTTCCTTCCTGGCCCTCCCAGGTCACCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCGGATGTCA
TGTTTGAGCACTTCCTTCTGCACAGAGAGGGGAAGTTTAACAACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTT
TCCAAGGCCAACTTCTCCATTGGTCCCATGATGCCTGTCCTTGCAGGAACCTACAGATGCTACAGTTCTGTTCCTCACTC
CCCCTATCAGTTGTCAGCTCCCAGTGACCCTCTGGACATGGTGATCATAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTGTCCTTGTCCTGCAGCTCCATCTATCCAGGGAGGGGGAGGCCCATG
AACGTAGGCTCCCTGCAGTGCGCAGCATCCACGGAACATTCCAGGCCGACTTTCCTCTGGGCCCTGCCACCCACGGAGGG
ACCTACAGATGCTTCGGCTCTTTCCGTGACGCTCCCTACGAGTGGTCAAACTCGAGTGATCCACTGCTTGTTTCCGTCAC
AGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTAACCCCAGACACCTACATGTTCTGA
TTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCTCCGACAAAAAAAAT
GCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGATTCTGATGAACAAGACCA
Genomic Sequence Data (15852 bps)
GTTTGGGAGGTTGGATCTAAGACGTGTTTTGAGTTGGTCATAGTGAAGGACGCGAGGTGTCAATTCTAGTGAGAGCAATT
TCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAAAGCCTGCGTACGTCACCCT
CCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCG
CGGCCGCCTGTCTGCACCGGCAGCACCATGTCGCTCATGGTCATCATCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAAT
AGAGGGAGGGAGCGTGGGGATGGAGATCTGGGCCCAGAGGTGGAGATATGGGCCTGGAGGTGGAGTTATGGGCCTGGAGT
GGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTAGAGATGGAGTGATTGGCCTAGAAGTGGAGATCTGCGCCTGGAGTGG
AGATCTGGGCCTGGAGTGAAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGGGATAGGAACCTGGAGTGGAGAG
AGGAACCTGGAGGAGAGATAGGAACCTGGAGGGGAGGTAGGAGCCTAGGGTGGAGATATGGGACTGGAGTGGAGATATGG
GACTGGAGTGGAGATATGGGCCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTATGGGCCTGGAGGTGGAGATATGGGCC
TGGAGTGGAGATATGAGCCTGGAGTGGAGATATGGTCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGCA
GTGGAGATATGGGCCTGGAGGTGGAGATATGGGTCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTATGGGCCTTGAGGT
GGAGATATGGGCCTGGAGTGGAGATATGGGACTAGAGTGGAGATAGGGGCCTGGAGGTGGAGATCTGGGCCTGGAGTGGA
GATCTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGCAGTGGAGATA
TGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTATGGGCCTGGAGGTGGAGATATG
GGCCTGGAGTGGAGATATGGGACTAGAGTGGAGATACGGGCCTGGAGGTGGAGATCTGGGCCTGGAGTGGAGATATGGCC
CTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGAGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGG
AGTGGAGATATGAGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGTG
GAGATATGGGTCTGGAGTGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGGTGGT
GATATGGGCCTGGAGTGTAGATATGGGCCGAGTGGAGATATGGGTCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATG
GGACTGGAGTGGAGATATAGGCATGGGGTGGAGACATGGGCCGGGAGTGGAGATATCGGACTGGAGTGGAGATACGGGCG
TGGGGTGGAGATATGTGCCTGGAGGTGGAGATATGGGCGTGGGTTGGAGATATGGGCCTGGAGTGGAGATATGGGCGTGG
GGTGGAGATATGGGTCTGGAGTGGAGACATGGGCATGGGGTGGAGATATGGGCCTGGTGTGTAGATATGGGCCTGGAGTG
GAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATCTGGGCCTACGGTGGAGATATGGGCCTAGGATGGGGA
TATGGGCCTGGAATGGAGATATGGGCCTGGGTGTGGAGATATGGGACTGGAGTGGAGATATGGGCCTGATGTGGAGATAT
GGGCTTGGAGTGGAGATATGATCCTGGAGTGTAGTTATGGGCCTGGAAGTGGAGATCTGGGCCTGGGGTGGAGATATGGG
CCTGGAGTGGAGATATGGGACTGGAGAGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGATTGGAGATATGGGCCTA
GGGTGGAGATCTGAGCCTGGATTGGAGATGTGGGCCCGGATTGGCTATATGGGTCTAGGGTGGAAATATCGGCCTGGAGT
GGAGATATGGGCCTGGAGTGGAGATATGGGCTTGGGGTGGGGATATGGGCCTGGAGGCTGGGTCTCTGCACAGCCGAGAG
CACTGTTCTTGGGTGCAGGTAGGCACTGATGGTGAGTTTCCCTTCGGCCCAGGAAGGGGCTGGCTATCAAGACTCACAGC
CCAGTGGGGGCAGCAAGGAAGGCCTTGTTTGCCTGCAAATGGATCTTCCATCATGATCTTTCTTTCCAGGGTTCTTCTTG
CTGCAGGGGGCCTGGCCACAGGAGGGTAAGTCCTTCTCCAAACCTTAGGGTGTCATCTCCCCACATAAGAGGATTTTCCT
GAAACGAGAGGGAAGTCCTGTCAGGGAGTCTCTCATAAACTAGGAAGAAGGGACCCTGGGGTGCTCGGCCCACAGTTCCG
ACCTTGCCTCCCTGGCCTCTCAACCCCTTGGCAGAGTCAAGTTGTGTGGGGACCAGGGTTGGACTAGGGTGTTCAAAGCT
GGGTTGTGTGGTGGGGAAGTGGTAGGAACAGCAGATCCTCTGAGGACAAAGGTGTTACTCACACACTTCAGCGTTTCCAT
GACGGTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCAGAAGAGGTGGGAAACCACAGCCATGGCCCTGACATTCCAAA
TCCTCTGATGGGGCTAAGTTTTTTATTCTCATTCAGGCAACTGCTGATATTCCATTCTCAAAGGACATGCCCTCCACTTC
ATGTCTACCCTGTGTTGTTTTATGTCAGTAATCTTACAGTATTAAAATCTAGTAGGAGTCTCTTACTCAGCACTTGCTCA
AAGTTCTCAGCTGACACTTTTGTTGTACGGAGACACCTTGTCTTTGTGGGATGGGTCCTTCCTTTAGCCCTAGGCACCAA
GGTGTGATAGCAGCCATAGAAATGTGGAAAGTGGGGAGAATCTTCTGAGCACAGGGAGGGAGGCACAGCTCCACATCCTC
CTCTCTAAGGCGGCGCCTCCTTCACCCCAAGGTGGTCAGGACAAGCCCTTGCTTTCTACCTGGCCCAGCCTTGTGGTGCC
TCCAGAACATGTGACTCTTCAGTGTCACTCTAATCTTGGGTTTAACAACTTCAGTCTGTACAAGGATGATGGGGTGCCTG
TCCCTGAGCTGTACAACAGAATATTCTGGAAAAGCCTTTTCATGGGCCCTGTGACCCCCTCACATGCAGGGACCTATAGA
TGCCGGGGTTCACACACACACTCCCCCAGTGGGTGGTCGGCACCCAGCAACCCCCTGGTGATCATGGTCACAGGTCAGAG
GGCTCCTGTCTGGGATTCTCCTTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTAGGCATGTCCTTGAGGGTCCCATCAC
GCAGGCCCTAACTGTATTTGGGGTAAAGGGGGATTGAATACAGGGAAATGGGTGCTGTGGTGGGAAGAATAAGTGTCCCC
AATGATGACTGCATTCTAATCCCTGGAGTCTGTGACTATTTATGTTATAGGGGAAGGGACTGAAGGGGAAGATGGAGCTC
AGGTTGTTGATGAGTTGACCTTGAGATGGGGAGACAGCCTGGACTGTCCCGGTGGGCTCAGTATAATCACAAGTGTCCAC
ATGAAAGGAGGAGGAAGAGGAGAGTGGGGATTAGAGCAGCGTAGTGGGAGACTCCATCAGCTTTGAAGGTGGATGAAGGC
CATAAGCCATGAATGCAGGTGGCCTATAGAGGCTGGGAAAGTCAAGTAACTGATTCTCCTGAGTCTCCAGAGGGAACACA
GCCCTGCAGATGCCTTGATTTTAGCCCTCGAAAAACAGGGTCCGCTTTCTGTCTCCAGAATCGGAGGGGGTCAGTGTGCT
CTCTCCTGCTGCCATGCTTCTGATAATTTTCTACAGCAGCAACAGGAAACCAACACTGGAACCCAGGTCAAGGACAAGTT
AAGAAAAGACACAAGGATAGCCAGGCATGGTGGCAGGTGCATGTAATCCTAGCGACTCGGGAGGCTGAGAGCAGGAGAAT
CGCTTGAACCCAGGAGACAGAGGTTGCAGTGAGCGTAGACCACACCACTTCACTCCAGCCTGGGCGAAGGAGTGAGACTC
TGTCTCCAAAATTAATTAATTAATTAAAGAAACCAAACAAAGAGAAGGTTGGCTACACCGAGATCAGCAAGGGTGGGATG
ATGATGCCACCACCAGGCTCCATCCACATAGGGAGGGGTTGATACTCCTCAAATCAGCACGAGGAGCCAGCCTATGGAAA
CTGGCACCATGGAGAAGGCACAGGCATGGCAAGAGTGGCTCCCAGTCCCCACCAGGAACAGGGTGTGTGGACACTGGTGC
CTGCCTTACTGATCAGTTCATACCTCCTGCCAAGGATTCCAATTCGTCCAAAAGAGATTGAACCAGGCTGCTAAGAGCCG
GGACGTGCAGCCTATCCTGCTTCCTCTTCCACTCCCACATAGACAGTAAGAAAGACATTAGTGTGAAATAGATACAACAG
CCCAAGAGATGAGGCTGAGCCCAGTGGGAAGGGAACCACAGCTACTAGAGACAGAGAGACAGAGAAGAGGGAGGGAGACA
GATGGAAGGACCTGCACCAGGAGTTATGGGCACAGAAAAGAACATGAAGACACAGAGAGGAAGCAGAGAGACAGACACCA
GCGAAGGGAAGGCTCACTCATTCCAGGTGCCATGGATGGGATGATAAAGAGAGACACCTTCTAAACTCACAACCTCTCTT
CCTAGGAGTCCACAGAAAACCTTCCTTCCTGGCCCTCCCAGGTCACCTGGTGAAATCAGAAGAGACAGTCATCCTGCAAT
GTTGGTCGGATGTCATGTTTGAGCACTTCCTTCTGCACAGAGAGGGGAAGTTTAACAACACTTTGCACCTCATTGGAGAG
CACCATGATGGGGTTTCCAAGGCCAACTTCTCCATTGGTCCCATGATGCCTGTCCTTGCAGGAACCTACAGATGCTACAG
TTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCTCTGGACATGGTGATCATAGGTGAGAGTGTCCAGA
CTTTCTTCTCATTGTCATTGGGATGCAGAGTGAATGATCCAGGACTTGGAGACCCAGGTGGTTGTAAGGAAGATGAGCTT
GGTATTCTTATGGAGAGAGACTGACTTGGTGAGGTCTGTGCCAACAGAGACAGAGAAACAAGAGACACAAGTACAGACCA
GGTGTCATAACAGAGGACAAACACAGGGGCCATACAGGGAGTTAGAAAAGACAGAAAGAGTTAAAGGAGACAGACAGACA
TGTCCCAGACAGAGGTGTCCTTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTACC
TCCACAAAGTGTTCTCTACCAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTT
GTGGCACCTACAGATGCCATGCTTATTCTGACACCTCTGACTTCCATGCAATGGAGAATAATCGTCCCAAAATATCATGG
CCCCAGAACACCAACCCCTGTATGCTGTGTGAACTTGTGGTCTCCAGACTGGATTCTGAGGCTCACATTCCAAATAACCC
CACATATCACATATGAGAGGATCACTGAGAAGCACAGAGAGAAATCAGGGACACCAAAAAGCAAAGACATAAACACACAG
AGAAAGAGCCAGAGGAAGGAGATTGAGAGACTCACAGACACATAAAGAGAGAGAAGAGGGCAGAGAAGTGGAGAGAATGA
TGGAAGAGAGCAGAGAAAACCACTAAAATTAGAGTCCTGAGGGTGAGGCACAAGGGCATAGAAAGATGGAGATGTGGGGA
TGAATTGCAGAGATTCCAAAGAGAACTAGAGAGACCGAGAGGCAGAGCAAGACAGATGATAGATGGATAGATACAGATAG
ATGATGGATAGATATAGATAGATGATATATAGGTAGATGATAGATAATAGGTTATAGATACATAGATGATGATTGATTGA
TTCATTAATAGATGATACATAGAGATGATGATGATGAAGATAGATGGATAGATAATACATAGAGATAGAGAGGAAGACAA
AGAGAGAAATAATAGAGAGAGAGAGATGATACATATATATAGATAATAGATGATTGACGGATAGACAATTGATAGATACA
TAGATGATATATAGATATAGATGACAGGTAGAGAATTTGTAGATAGGCACCGAATAGATAAATAGATGGATTGATAGATA
ATAGATAGAAATATGCAGAAAGTTATGAACGGGACACAAACTGAGAAACTCAGAGTTAAAAAAAGTAACATCAAGTCAAC
CAATCCAAGGAGAGCCAGAGAGAATAAAACAATCCAAAAACGGAAAACATAACTAGAGGTAGGGAAGTGAGGTCAGAGAC
CTACAGACACAGAGAAGGTGGAAGGAGGAAATAGACATGAAGAGAGATGGGGTGGAGGGTGAGACAGAGAAAGAGAGCAT
TAGGCCATAGAGCAGGGGAGTGAGTTCTCAGGTCAGGTGTGAGGGGAGCTGTGACAAGGAAGATCCCCCCTGAGGAAACT
GCCCCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAATG
TGTCCTTGTCCTGCAGCTCCATCTATCCAGGGAGGGGGAGGCCCATGAACGTAGGCTCCCTGCAGTGCGCAGCATCCACG
GAACATTCCAGGCCGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGACGCT
CCCTACGAGTGGTCAAACTCGAGTGATCCACTGCTTGTTTCCGTCACAGGTGAGGAAACCCCATATCTGTCCCATGTCCT
ATGATCCTAGAGCCTTAGCTGAGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGACAGATGCAGAGAGAAGACGCAGCA
TGCCTGTGAGGGAGGGATCAGGGTGCAGGATGGCACACACAGCACCTCCAAACCCTCCTGCATGGCCTGCATGGAGGCCT
CCGATTAGGGCTCCAGGCACCCAGGCAGATGTAGAAAGCGGTCAGGAGAGACCCAGAGAAGGGGAGACTGGGCTCAGTTT
GGGGAGATCAGAGGTTCCCTCAGCCCCTCAACCTTACCCATTTCCCAGAAGCCCTTCCTGGCCTCTCACCCACACAGAGA
TGTCATCACCAGCAACCCCTACATCCTTTTCTTTTTGTTTGAAAAAATATTTATTGAGGTTAAATATACCTATATAGCTT
ACCACTTTTAACATTTTTTTTTTTTGAGGTGGAGTCTAGCTCTGTCTCCTATGCTGGAATGCAGTGGCACAATCTCAGCT
CACTGTAACCTCCGCCTCCTGGGTTCAAGCGATTCTCCTGCCTCAGCCACCTGAGTAGCTGGTACTACAGGCGCCCATCA
CCACGCCAGGCTACTTTTTGTATTTTTAGTAGAGAGGGGGTTTCACCATGTTGGTCGAGCTGCTCTGGAACTCCTGACCA
CGTGATCCACCCGCCACAGGCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCGCGCCCGGCCACGTTTACCAATTTT
AAGTGTAAGGTCTAGTGGTCATAAATACATACATATAAATTTTTTGTTTGTTTGTTTTATCCTCCACCCTTTTCTTCCTG
GCCTCTGGTAGCCACCATTCTACTCTCTATCTTCATGAGATCCACCTTTTAGCTCCTGTATATGGGTGAGAAATGAGAAT
ATTTGTAATGACTTCCAGTTCCATCCATGTGGCTGCAAATATCAGGATGTTATTCTTTCTATGGATGAGTAGTCTCCGCT
GTGCGTATGTACTACATTCTCTCTATCCATTCATCCACTGATGGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAA
GAGTGCTGCACCAATCATACGAGTGCAGATATCACTTCGATACATTGATTTACTTTCCTTTGGATATAAACCCAGTAGTG
AAATTGCTGGATACTATGAAAGTTCTCTTTTTAGTTTTTCGTTTGTTGTTTTGTTTTTGTTTTTGAGACAGTTTCCCTCT
GTGCCCAGGCTGGAGTACAAGTGATGTGATCTTGGCTCATTGCAACCTCCGCCTCCTGGGTTCAAATGATTTTCCTGCCT
CAGCCTCCCTAGTAGCTGGGATTACAGGTGCACGCCACCATGCCGGGATACTTTTTGGTTTTTTTTAGTGTACATGGGGT
TTCCCCAGGTTGGCTAGGCTGCTCTCAAACTCATGACCTCAACTGAGGTGCCCGCCTCGGTCTCCCAAAGTGCCGGGATT
ACAGGCATGATCCACTTCATCCAACCTCTTTTTAGTTCTTTAAAGGACTTCCATACTTTTCTCCGTAATGGCTGTACTAA
TTTACACTCCTACCAACAGGGTACCAGGGTTCTCCTTTCTCTACCACCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGCT
AAAAGCCATTTTATTTTATTTCATTTTATTTTGAGATGGAGTTTCGCTCTTGTCACCCAGGCTGGAGTGCAGTGGTGCGA
TCTCGGCTCACCGCAACCTCCACCTCCCAGGTTCAAGCGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGAATTACAGGC
ACACGCCACCACGCCCGACTAATTTTTGTATTTTTAGTAGAGACAGTGTTTCTCCATGTGGGTCAGACTGGTCTCAAACT
CCCGACCTTATGAGATTCGCCCACCTCGGGCTCTCAGAGTTCTAGGATGACAGACATGAGCCACCTCGCCCGGCCTAAAA
GCCATTTTAATGGGGTGAGATGAAAACTCACTTTGATTTTAATTCGCGTTTCTCTGATGATGAGTGATACTGAGCACTTT
TTCGTATGTGGGGAAATTTCATGTCTTTTGCTCCTTTTTCAATTAAATCATTTGTTTTATTGAGTTGTTTGAGCTTCTTA
TACTTCTAGTTATTAATCCCGTCTCAGAAGCATAGTTTGCACATATTTGCTCCCAATCTGTGGGTTGTCTCTTCACTTTG
TTGGTTTATTTTTAGCGGTGCAGAAGTTGCTTAGTTTGAGGTAATCCCAATGGTCTATTTTTGCTTCAATTACTTGTGTT
TTGAAGGTTTAAAACAAAATGTCTTCCTTCAGACAAATGTCCTGGAGCATTTCCCCAATATTTTCTTCTACGTGTTTCAC
AGGTTCAGGCCTTAGACTTACATCTTTAATCCACTTTCATTTGATTTTTGTGTATGGTGACAGGTAGAGGTGCAGTTTCA
TTCCTCTGCATGTAGATGTCCAGGTTTCCCTGCACTGTTTATTGAAAAAACTGTCCTTTCCTGATTGTGAGTTCTTGGCA
CCTTTGTCAAAGTCCATTGGATGGGCTGGGCATGGTGGCTAACACCAGCAACTTCAGCACTTTGGGAGGCCAAGGCTGGT
GGATCACCTGAGGACAGGAGTACAAGATTACTCTGGCCGACGTGATGAAACATCGTCTCCACTAAAAATATAAAAATTAG
CTGAGCATGGTGGTCAGCACCTGTAATACTACTACTCAGGAGTTTGAGGCAAGAGAATTGATTGAACCCAGGAGGCTGAG
GTTGCAGTGAACCGAGATTGCACCTCTGCACTCCAGCCTGGGTGACAGAGCGAGACTCCATCTCAAAAGAAAAAATAAAA
AAAATTGGATGTAAATGCATGGATTATATCTGTGTTCTTCATTCTGCTCCGTTGTTCTATGTGCCTTTCTTCATGCCAAC
ATCATGCTGTTTTGCTTACTACAGCTCTGTAACATATTTTGAGATCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACC
TTGAAGTCTCAAGACAGTGGGCGTCACATACAAAAATTATGGAAGAAAGGATCCCTGGACTCCCAGGGCCCAATGTTAGA
TAACAGAGTGTTGGCCATGAACCATCCTCAAAGATTTCCATTGAGTAGAGGACAGACACCCGCATTTCCTCACCTCTCTC
CTGTCTCATGTTCTAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTGAGTACAGGAC
CCTCTTATATCTGCTTTTGGAACCCTGGGGAGGTGGAAACCTTGGATTCAGGCGTTGACTCAGCATCTCACAGCTCTGAC
ATTGTACGCCTGTCTTCTACCATCTCCGAACTCCAGATACTCCAACAGCGAAAGGGATCTGGGCCCAACACAGGGCTCAG
TGAAATCTCTTCATCTCTCATTTTATGGAGCTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCT
CAGGAAAAATGCAATGTTTGTTCTGCTTGCATTCCTAACTGGAGGATAAATTCCTGGGGGCTTGAGAGAGGGAAGGGAAG
GGAACATCTGATGAGGGCGAGGTGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAGCTCCTGTTGGTCATGAAACAACCC
TGGCTGACTCAGCAGAGCAAGAGCCTTGCCGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTTATT
CAGCCACGGCCCCATGCTCAGGTTGTGCAGTGTGGAAGCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTG
GGTGAAAACAAAACGGTTATTTAATTATCTTACAGTGCTCTAGCTCAAAGCATGAAGTGCATCTCACTGGGCTAAAATCA
AGATGACAGCAAGCCTGCCTTCCCTCTGAGGATTCCAGGCAAGAATCTGCTTCTCACTTGTCCCATCTTATAAAGGCTCC
CAGTTCTTTGGCTGCTGGTCCCCTTCCTCCTTCCTCAAAACCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGA
CCCTTCTTCCTTACCACACCTCTTTCTCTGAATGCTGCTCTCCCTTCTTCCTCATCTTTTGAAAACTTGGGGATTCTATT
GGGTTCACCAAGATGAAAATCTGTCATAATCTCCCGGAAATCATTCAGGATACCCTTGTTTTAAGTTCAGCTGATTAGCA
ACCGTAATTCCATCTGCAATCTTCATTCCTCCTTTCCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACAGGG
ACATTTTGGGGTGGGACAGCATTCTCCTGCCTTCCACAAATGGTGAACAAGATGCATTTGGCCTCTGCTCTTGGGACACT
GATATTGCAGATGGTTAAATGGGAGGACAGAAAATGAATGCACAAGTGGACCAATAAATGAATGATCCATTGGGAAGCAT
CTGTGCATGAAATCTATTTGTTTGTTTGTTCGTTTGTTTATTGAGACAGAGTCTCCCTCTGTCTTCCAGGCTACAGTGCA
GTGTCACGATCTTGGCTCACTGCAACCTGCGTCTCCTGGATCCAAGTGATTCTCCTGCCTCACCCTCTTGAGTAGCTGGG
ATTACAGGCAACTGCCACCATGCCCGGCTAATTCTTTTTGTATATTTTTTGTAGAGAGGATGTTTCACCATGTTGGCCAA
GCTTGTCTGAAACTCCCAACCTCAAGTGATCCGACCATCTCAGCATCCCAAAGTACTGGGATAAAAGACGTGAGCCACTG
TGCCCAGCCAGAATTCAAAATCAATAATAGATAATGCTGAGTGTATAATTTTGGGTGACAGAGAAGGTCTCACTATTCAG
ATATTTGTGACATTAATGAAAAACACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTTTGCACACACAGCTGTCAGCC
GTGAAGGCAGAAAGCTGAAAACAATCTGATGTGGAAGGAAGAGGCTCTGCCTCAAATGCTGGGAATGATGTGGGGAGAAT
GACAAGATGACTGTAGGGAGACGGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACAC
TCACAGCCATTGGACTCACCTCGAGGTAACCAGGAATCCCTACATGATTAATATGACGGACATGAAAATAAGGGAGGCTC
AGTTGCATAACTGGAATCTAGGAGACCGTGGAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACAC
TAAATGAATGAAGTAGATGGATATAAGATATGCTTGTGAGGTAGAATCATTGGCTGGAAAGGCTTGCTGGGTTTGATTTT
CCTACTTGTTTAATCCTCGCTTAATTAATTTCTTTCTGAGATTTATTCATCCTACACATAAATCAATACCTGGCAAAGGA
GTGACAGATATATGAGGGGTGGTGGAAATGAAGAGACCTATTATAGCATAATATACAAGTTGTGAACGGTGGCTCACGCT
TGTAACCCAGCACTGCAGGAGGCCAAGGCGGGTGGATTCCATGAAGTCAGGAGTTCCAGACCAGCCTGGCCAACATGGTG
AAACCCTATCTGTACTAAAAATACAAAAATTAGCCGAGCATGGTGGTGCATCCCTGTAATCCCAGCTCCTACTCTGGAGG
ATGAAGCAGGAGAATGACTTCAACCCAGGAGGTGGAGGTTGCAGTGAGTGGAGATTGCATCACTGCACTCCAGCCTGGGT
GACACAAGGAGACTCCGTCTCAAAAAATAAAAATAAGAAATGCATAAATATAATAAAACACACACGAATGACAAAGGCAC
CTGAATTCCAATCATCATTTTTCTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATGAGCCTA
AAACCTCTTCCCTATTTGGCTTTCTGTGAGCATGAGATCACATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCACGGA
TCCTGGAATAGAGAAAGTGCTCTGGTCATCGCAAAAAAAAACTTGCCCACTCACCCAAATCCCCCACCTCACCCCTACTT
CCAATCACCTGTGGAGATTCAGATAGACCATGGGGAGGAAACATTAATACTCCTTGGAGTGAGTCCAGATCTTGGAATCA
GAGATCAGCGACAGCACTAGCTCCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTATTGAAGCAATAGATGG
TCGAGGGGGTGGTCCTTCCCCCAGCCTCTCGGGTAGAACAGCAGCCTAACATGTGTCTCCCGAGATCACAAAGAGCAGCA
CATTTCACACGGGCTTCAACACTATTTCCTGGCCGTTTGACATAAGAGAATCTTGCTTCGCTATTTTTAATCGTGATGTC
ACCTTTGTTTCCTTTCCTTGGTGAATGCAATTTGTTTGACTCAAGAATGCTGTGGATGTAGAAATCCTAAAGCACATTCG
CTGTGTATCAATCCCAGTGCAGTCTTCCCAGAGAAGACTCTAAACAAATCCTGGACTGCACCTGGGCCTATGCCAATTCC
TATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAATACATTACACAGGCAGGTTCATTACTAACAGATAAGCA
GCGAGTGACAACAGAAGCCTGCATTTCAATGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTGCTCGGGACATATGGAGTC
ACCCCATTTGCAGTGTAGCTGGGGGAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTC
AGCTAAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGAGACATTCCTCCTGATCT
CAGGATGTTGCTATCTTAGTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGGGTAACTTCTAAAGAAAAGAGATTG
GTTTGCCTCACAGTTCTGCAGGCTGTACTGGAAGCATGGCACCAGAATCTATTTCTCGTGACGGCCTCAGGCTGCTCCCA
CTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCGCAGAGATCACACGGCAAGAGAGAGAGTAAGGGGGAGAGG
GAGCAATGGAGCTTCCAAGCTCTTTTTAACAACCAGCTCTCCAGGAACTAACAGAGGGGGAACTTGCTAACCCCGTCTCC
TTGGGACAGCATTGATCTGTTCATGATGGATCCACCTCCATGACCCAAACACCTCTGAAGAGGCCCAACCTCCCACAATG
GGGGTGAAATTTCAATGTGAGGTTTGAAAGGGTCAAACATCTCAACTAAAGTAGTTGTATCCTCAGCACGTTCTATGGTT
ACTATGAGAGCTATAATTGAGAAAGCAGGGGAAAGCTAGGTCTCCCGCCATTTGGGTGCTTGTCCTAAAGAGACGTTGTA
TGTGGTTACCTGCCAATCAAGAAATGCGAGACAATTCATAAAGAGGAACTGCTATGATTAGCTTCTTATTGGTGTCTCCT
CTTCTTCCAGGTAACCCCAGACACCTACATGTTCTGATTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTT
CTTTCTCCTTCATCGCTGGTGCTCCGACAAAAAAAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGG
GAAGCAGGATGGGAGCACGCGGATGTGTGTTCCTCACCAGCAGGATGGTCCCTGGCCCAAGACAGGAGCCACAGAGGCAG
GACTTTCTAGAGAGAGCACCAGATTCCCTTCCCCTGCCTTCAGCTCACAGACCATTGCCTGATTCTGAACTGTATCCTCA
CGTCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGAGATAGAATCAATGGGATGGGACC
TCAGAGCTATTCATGGGATGGGTCCTTGAACTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCA
GGCACCTATGGCCTCCCCCTGTTTGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTCTTTTGTTG
ACTTCCGTCTTCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGTAGGTGCTC
CTCGGCCCAGCCTCGTGGCTAGTCTTATTCCCAAAGAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCT
CTCTCCAGGATTCTGATGAACAAGACCATTGGATCACTGTGTTTTCACACAGAGAAAAATCACTCCCCCTTCTCAGAGGC
CCAAGACACCCCCAACAGATACCAGCATGTACATAGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTTCTGTCCA
CGAGCACCACAGTCAGGCCTTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATG
TACCAGCAGCTGGAATCTGAAGGCATCAGTCTTCATCTTAGGGCATCGCTCTTCCTCACACCACGAATCTGAACATGCCT
CTCTCTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAGAAAACACACTCCTTTGCTTAGCCCACAATTCTCC
ATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTACCTGAGGCTGCAATCACACTGAGGA
ACTCACAATTCCAAACATACAAGAGGCTGCCTCTTAACACAGCACTTAGACACGTGCTGTTCCACCTCCCTTCAGACTAT
CTTTCAGCCTTCTGCCAGCAGTAAAACTTATAAATTTTTTAAATAATTTCAATGTAGTTTTCCCGCCTTCAAATAAACAT
GTCTGCCCTCAT

IPD-KIR