Allele Report for 2DS4*0030103


2DS4*0030103
Previous Designations & Local Names: FH06_BA1
IPD Acc No: KIR00430
Assigned: 28-AUG-2009 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182341  
Cells Sequence Derived From: FH06  
Known Ethnic Origin Of Source: Hispanic
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (240 aa)
MSLMVIIMACVGFFLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHREGKFNNTLHLIGEHHDGV
SKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDMVIIGLYEKPSLSAQPGPTVQAGENVTLSCSSIYPGKGRPM
NVGSLQCAASTEHSRPTFLWALPPTEGPTDASALSVTLPTSGQTRVIHCLFPSQETLQIVGLHPLNQAPKPVTPDTYMFX
Nucleotide Sequence Data (893 bps)
ATGTCGCTCATGGTCATCATCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACAGGAGGGAGTCCACAG
AAAACCTTCCTTCCTGGCCCTCCCAGGTCACCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCGGATGTCA
TGTTTGAGCACTTCCTTCTGCACAGAGAGGGGAAGTTTAACAACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTT
TCCAAGGCCAACTTCTCCATTGGTCCCATGATGCCTGTCCTTGCAGGAACCTACAGATGCTACGGTTCTGTTCCTCACTC
CCCCTATCAGTTGTCAGCTCCCAGTGACCCTCTGGACATGGTGATCATAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCATCTATCCAGGGAAGGGGAGGCCCATG
AACGTAGGCTCCCTGCAGTGCGCAGCATCAACGGAACATTCCAGGCCGACTTTCCTCTGGGCCCTGCCACCCACGGAGGG
ACCTACAGATGCTTCGGCTCTTTCCGTGACGCTCCCTACGAGTGGTCAAACTCGAGTGATCCACTGCTTGTTTCCGTCAC
AGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTAACCCCAGACACCTACATGTTCTGA
TTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCTCCGACAAAAAAAAT
GCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGATTCTGATGAACAAGACCATCAGGAGGT
GTCATACGCATAA
Genomic Sequence Data (16070 bps)
GTTTGGGAGGTTGGATCTAAGACATGTTTTGAGTTGGTCATAGTGAAGGACGCGAGGTGTCAATTCTAGTGAGAGCAATT
TCCAGGAAGCCATGTTCTGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAAAGCCTGCGTACGTCACCCT
CCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCG
CGGCCGCCTGTCTGCACCGGCAGCACCATGTCGCTCATGGTCATCATCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAAT
AGAGGGAGGGAGCGTGGGGATGGAGATCTGGGCCCAGAGGTGGAGATATGGGCCTGGAGGTGGAGTTATGGGCCTGGAGT
GGAGATCTGGGCCTAGAGATGGAGTGATGAGCCTAGAAGTGGAGATCTGCGCCTGGAGTGGAGATCTGGGCCTGGAGTGA
AGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGGGATAGGAACCTGGAGTGGAGAGAGGAACCTGGAGGAGAGAT
AGGAACCTGGAGGGGAGGTAGGAGCCTAGGGTGGAGATATGGGACTGGAGTGGAGATATGGGACTGGAGTGGAGATATGG
GCCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTATGGGCCTGGAGGTGGAGATACGGGCCTGGAGTGGAGATATGAGCC
TGGAGTGGAGATATGGTCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGCAGTGGAGTTATGGGCCTGGA
GTGAAGTTATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGATATGGGACTAGAGTGGAGATAGGGGCCTGGAGGT
GGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAG
ATATGGGTCTGCAGTGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTA
TGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGATATGGGACTAGAGTGGAGATAGGGGCCTGGAGGTGGAGATCTG
GGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGAGCCTGGAGTGGAGATATGGCCC
TGGAGTGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTATGGGCCTGG
AGGTGGAGATATGGGCCTGGAGTGGAGATATGGGACTAGAGTGGAGATACGGGCCTGGAGGTGGAGATCTGGGCCTGGAG
TGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGAGCCTGGAGTGGAGATATGGCCCTGGAGTGGA
GATATGGGCCTGGAGTGGAGATATGAGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATA
TGGGCCTGGAGTGGACATATGGGTCTGGAGTGGAGATACGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGATATGG
GCCTGGAGGTGGTGATATGGGCCTGGAGTGTAGACATGGGCCGAGTGGAGATATGGGTCTGGAGTGGAGATATGGGCCTG
GAGTGGAGATATGGGACTGGAGTGGAGATATAGGCATGGGGTGGAGACATGGGCCGGGAGTGGAGATATGGGACTGGAGT
GGAGATACGGGCGTGGGGTGGAGATATGTGCCTGGAGGTGGAGATATGGGCGTGGGTTGGAGATATGGGCCTGGAGTGGA
GATATGGGCGTGGGGTGGAGATATGGATCTGGAGTGGAGACATGGGCATGGGGTGGAGATATGGGCCTGGTGTGTAGATA
TGGGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATCTGGGCCTACGGTGGAGATATGGG
CCTAGGATGGGGATATGGGCCTGGAATGGAGATATGGGCCTGGGTGTGGAGATATGGGACTGGAGTGGAGATATGGGCCT
GATGTGGAGATATGGGCTTGGAGTGGAGATATGATCCTGGAGTGTAGTTATGGGCCTGGAGGTGGAGATCTGGGCCTGGG
GTGGAGATATGGGCCTGGAGTGGAGATATGGGACTGGAGAGGAGATATGGGACTGGAGTGGAGATATGGGCCTGGAGTGG
AGATATGGGCCTGGATTGGAGATATGGGCCGAGGGTGGAGATCTGAGCCTGGATTGGAGATGTGGGCCCGGATTGGCTAT
ATGGGTCTAGGGTGGAAATATCGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCTTGGGGTGGGGATATGG
GCCTGGAGGCTGGGTCTCTGCACAGCCGAGAGCACTGTTCTTGGGTGCAGGTAGGCTCTGATGGTGAGTTTCCCTTCGGC
CCAGGAAGGGGCTGGCTATCAAGACTCACAGCCCAGTGGGGGCAGCAAGGAAGGCCTTGTTTGCCTGCAAATGGATCTTC
CATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACAGGAGGGTAAGTCCTTCTCCAAACCTTAG
GGTGTCATCTCCCCACATAAGAGGATTTTCCTGAAACGGGAGGGAAGTCCTGTCAGGGAGTCTCTCATAAACTAGGAAGA
GGGGACCCTGGGGTGCTCGGCCCACAGTTCCGACCTTGCCTCCCTGGCCTCTCAACCCCTTGGCAGAGTCAAGTTGTGTG
GGGACCAGGGTTGGACTAGGGTGTTCAAAGCTGGGTTGTGTGGTGGGGAAGTGGTAGGAACAGCAGATCCTCTGAGGACA
AAGGTGTTACTCACACACTTCAGCGTTTCCATGACGGTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCAGAAGAGGTG
GGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGATGGGGGCTAAGTTTTTTATTTTCATTCAGGCAACTGCTGA
TATTCCATTCTCAAAGGACATGCCCTCCACTTCATGTCTACCCTGTGTTGTTTTATGTCAGTAATCTTACAGTATTAAAA
TCTAGTAGGAGTCTCTTACTCAGCACTTGCTCAAAGTTCTCAGCTGACACTTTTGTTGTACGGAGACACCTTGTCTTTGT
GGGATGGGTCCTTCCTTTAGCCCTAGGCACCAAGGTGTGATAGCAGCCATAGAAATGTGGAAAGTGGGGAGAATCTTCTG
AGCACAGGGAGGGAGGCACAGCTCCACATCCTCCTCTCTAAGGCGGCGCCTCCTTCACCCCAAGGTGGTCAGGACAAGCC
CTTGCTTTCTACCTGGCCCAGCCTTGTGGTGCCTCCAGAACATGTGACTCTTCAGTGTCACTCTAATCTTGGGTTTAACA
ACTTCAGTCTGTACAAGGATGATGGGGTGCCTGTCCCTGAGCTGTACAACAGAATATTCTGGAAAAGCCTTTTCATGGGC
CCTGTGACCACGTCACATGCAGGGACCTATACATGCCGGGGTTCACACACACACTCCCCCAGTGGGTGGTCGGCACCCAG
CAACCCCCTGGTGATCGTGGTCACAGGTCAGAGGGCTCCTGTCTGGGATTCTCCTTGTCCCACCTCCTGAATCCCAGAGC
TTCTGGTAGGCATGTCCTTGAGGGTCCCATCACGCAGGCCCTAACTGTATTTGGGGTAAAGGGGGATTGAATACAGGGAA
ATGGGTGCTGTGGTGGGAAGAATAAGTGTCCCCAGTGATGACTGCATTCTAATCCCTGGAGTCTGTGACTATTTATGTTA
TAGGGGAAGGGACTGAAGGGGAAGATGGAGCTCAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGACAGCCTGGACTGT
CCCGGTGGGCTCAGTATAATCACAAGTGTCCACATGAAAGGAGGAGGAAGAGGAGAGTGGGGATTAGAGCAGCGTAGTGG
GAGACTCCATCAGCTTTGAAGGTGGATGAAGGCCATAAGCCATGAATGCAGGTGGCCTATAGAGGCTGGGAAAGTCAAGT
AACTGATTCTCCTGAGTCTCCAGAGGGAACACAGCCCTGCAGATGCCTTGATTTTAGCCCTCGAAAAACAGGGTCCGCTT
TCTGTCTCCAGAATCGGAGGGGGTCAGTGTGCTCTCTCCTGCTGCCATGCTTCTGATAATTTTCTACAGCAGCAACAGGA
AACCAACACTGGAACCCAGGTCAAGGACAAGTTAAGAAAAGACACAAGGATAGCCAGGCATGGTGGCAGGTGCATGTAAT
CCTAGCGACTCGGGAGGCTGAGAGCAGGAGAATCGCTTGAACCCAGGAGACAGAGGTTGCAGTGAGCGTAGACCACACCA
CTTCACTCCAGCCTGGGTGAAGGAGTGAGACTCTGTCTCCAAAATTAATTAATTAATTAAAGAAACCAAACAAAGAGAAG
GTTGGCTACACCGAGATCAGCAAGGGTGGGATGATGATGCCACCACCAGGCTCCATCCACATAGGGAGGGGTTGATACTC
CTCAAATCAGCACGAGGAGCCAGCCTATGGAAACTGGCACCATGGAGAAGGCACAGACATGGCAAGAGTGGCTCCCAGTC
CCCACCAGGAACAGGGTGTGTGGACACTGGTGCCTGCCTTACTGATCAGTTCATACCTCCTGCCAAGGATTCCAATTCGT
CCAAAAGAGATTGAACCAAGCTGCTAAGAGCCGGGACGTGCAGCCTATCCTGCTTCCTCTTCCACTCCCACATAGACAGT
AAGAAAGACATTAGTGTGAAATAGATACAACAGCCCAAGAGATGAGGCTGAGCCCAGTGGGAAGGGAATCACAGCTACTA
GAGACAGAGGGACAGAGAAGAGGGAGGGAGACAGATGGAAGGACCTGCACCAGGAGTTATGGGCACAGAAAAGAACATGA
AGACACAGAGAGGAAGCAGAGAGACAGACACCAGCGAAGGGAAGGCTCACTCATTCCAGGTGCCATGGATGGGATGATAA
AGAGAGACACCTTCTAAACTCACAACCTCTCTTCCTAGGAGTCCACAGAAAACCTTCCTTCCTGGCCCTCCCAGGTCACC
TGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCGGATGTCATGTTTGAGCACTTCCTTCTGCACAGAGAGGGG
AAGTTTAACAACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTTTCCAAGGCCAACTTCTCCATTGGTCCCATGAT
GCCTGTCCTTGCAGGAACCTACAGATGCTACGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCTC
TGGACATGGTGATCATAGGTGAGAGTGTCCAGACATTCTTCTCATTGTCATTGGGATGCAGAGTGAATGATCCAGGACTT
GGAGACCCAGGTGGTTGTAAGGAAGATGAGCTTGGTATTCTTATGGAGAGAGACTGACTTGGTGAGGTCTGTGCCAACAG
AGACAGAGAAACAAGAGACACAAGTACAGACCAGGTGTCATAACAGAGGACAAACACAGGGGCCATACAGGGAGTTAGAA
AAGACAGAAAGAGTTAAAGGAGACAGACAGACATGTCCCAGACAGAGGTGTCCTTCCATGCTGACTTTGCTCAGAGACCT
GGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTGTTCTCTACCAGGAGAACCCAAGGACACCCATATTTC
TGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCACCTACAGATGCCATGCTTATTCTGACACCTCTGACTTCCAT
GCAATGGAGAATAATCGTCCCAAAATATCATGGCCCCAGAACACCAACCCCTGTATGCTGTGTGAACTTGTGGTCTCCAG
ACTGGATTCTGAGGCTCACATTCCAAATAACCCCACATATCACATATGAGAGGATCACTGAGAAGCACAGAGAGAAATCA
GGGACACCAAAAAGCAAAGACATAAACACACAGAGAAAGAGCCAGAGGAAGGAGATTGAGAGACTCACAGACACATAAAG
AGAGAGAAGAGGGCAGAGAAGTGGAGAGAATGATGGAAGAGAGCAGAGAAAACCACTAAAATTAGAGTCCTGAGGGCGAG
GCACAAGGGCATAGAAAGATGGAGATGTGGGGATGAATTGCAGAGATTCCAAAGAGAACTAGAGAGACCGAGAGGCAGAG
CAAGACAGATGATAGATGGATAGATACAGATAGATGATGGATAGATATAGATAGATGATATATAGGTAGATGATAGATAA
TAGGTTATAGATACATAGATGATGATTGATTGATTCATTAATAGATGATACATAGAGATGATGATGATGAAGATAGATGG
ATAGATAATACATAGAGATAGAGAGGAAGACAAAGAGAGAAATAATAGAGAGAGAGAGATGATACATATATATAGATAAT
AGATGATTGACGGATAGACAATTGATAGATAAATAGATGATATATAGATATAGATGACAGGTAGAGAATTTGTAGATAGG
CACCGAATAGATAAATAGATGGATTGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACGGGACACAAACTGAGAA
ACTCAGAGTTAAAAAAAGTAACATCAAGTCAACCAATCCAAGGAGAGCCAGAGAGAATAAAACAATCCAAAAACGGAAAA
CATAACTAGAGGTAGGGAAGTGAGGTCAGAGACCTACAGAGACAGAGAAGGTGGAAGGAGGAAATAGACATGAAGAGAGA
TAGGGTGGAGGGTGAGACAGAGAAAGAGAGCATTAGGCCATAGAGCAGGGGAGTGAGTTCTCAGGTCAGGTGTGAGGGGA
GCTGTGACAAGGAAGATCCCCCCTGAGGAAACTGCCCCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCATCTATCCAGGGAAGGGGAGGCCCATG
AACGTAGGCTCCCTGCAGTGCGCAGCATCAACGGAACATTCCAGGCCGACTTTCCTCTGGGCCCTGCCACCCACGGAGGG
ACCTACAGATGCTTCGGCTCTTTCCGTGACGCTCCCTACGAGTGGTCAAACTCGAGTGATCCACTGCTTGTTTCCGTCAC
AGGTGAGGAAACCCCATATCTGTCCCATGTCCTATGATCCTAGAGCCTTAGCTGAGGAGCTTCCTGCTGATGATGGAGAG
AAGCATGGACAGATGCAGAGAGAAGACGCAGCATGCCTGTGAGGGAGGGATCAGGGCGCAGGATGGCACACACAGCACCT
CCAAACCCTCCTGCATGGCCTGCATGGAGGCCTCCGATTAGGGCTCCAGAAACCCAGGCAGATGTAGAAAGCGGTCAGGA
GAGACCCAGAGAAGGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGTTCCCTCAGCCCCTCAACCTTACCCATTTCCCA
GAAGCCCTTCCTGGCCTCTCACCCACACAGAGATGTCATCACCAGCAACCCCTACATCCTTTTCTTTTTGTTTGAAAAAA
TATTCATTGAGGTTAAATATACCTATATAGCTTACCACTTTTAACATTTTTTTTTTTTTGAGGTGGAGTCTAGCTCTGTC
TCCTATGCTGGAATGCAGTGGCACAATCTCAGCTCACTGTAACCTCCGCCTCCTGGGTTCAAGCGATTCTCCTGCCTCAG
CCACCTGAGTAGCTGGTACTACAGGCGCCCATCACCACGCCGGGCTACTTTTTGTATTTTTAGTAGAGAGGGGGTTTCAC
CATGTTGGTCGAGCTGCTCTGGAACTCCTGACCACGTGATCCACCCGCCTCAGGCTCCCAAAGTGCTGGGATTACAGGCA
TGAGCCACCGCGCCCGGCCACGTTTACCAATTTTAAGTGTAAGGTCTAGTGGTCATAAATACATACATATAAATTTTTTG
TTTGTTTGTTTTATCCTCCACCCTTTTCTTCCTGGCCTCTGGTAGCCACCATTCTACTCTCTATCTTCATGAGATCCACC
TTTTAGCTCCTGTATATGGGTGAGAAATGAGAATATTTGTAATGACTTCCAGTTCCATCCATGTGGCTGCAAATATCAGG
ATGTTATTCTTTCTATGGATGAGTAGTCTCCGCTGTGCGTATGTACTACATTCTCTCTATCCATTCATCCACTGATGGGC
AGGTAGGTTGACTCCACATCTTGGCTACTGTGAAGAGTGCTGCACCAATCATACGAGTGCAGATATCACTTCGATACATT
GATTTACTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGATACTATGAAAGTTCTCTTTTTAGTTTTTCGTTTGT
TGTTTTGTTTTTGTTTTTGAGACAGTTTCCCTCTGTGCCCAGGCTGGAGTACAAGTGATGTGATCTTGGCTCATTGCAAC
CTCCGCCTCCTGGGTTCAAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCTGGGATTACAGGTGCACGCCACCATGCCGG
GATACTTTTTGGTTTTTTTTAGTGTACATGGGGTTTCCCCAGGTTGGCTAGGCTGCTCTCAAACTCATGACCTCAACTGA
GGTGCCCGCCTCGGTCTCCCAAAGTGCCGGGATTACAGGCATGATCCACTTCATCCAACCTCTTTTTAGTTCTTTAAAGG
ACTTCCATACTTTTCTCCGTAATGGCTGTACTAATTTACACTCCTACCAACAGGGTACCAGGGTTCTCCTTTCTCTACCA
CCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTTATTTCATTTTATTTTGAGATGGAGTTTCG
CTCTTGTCACCCAGGCTGGAGTGCAGTGGTGCGATCTCGGCTCACCGCAACCTCCACCTCCCAGGTTCAAGCGATTCTCC
TGCCTCAGCCTCCCGAGTAGCTGGAATTACAGGCACACGCCACCACGCCCGACTAATTTTTGTATTTTTAGTAGAGACAG
CGTTTCTCCATGTGGGTCAGACTGGTCTCAAACTCCCGACCTTATGAGATTCGCCCACCTCGGGCTCTCAGAGTTCTAGG
ATGACAGACGTGAGCCACCTCGCCCGGCCTAAAAGCCATTTTAATGGGGTGAGATGAAAACTCACTTTGATTTTAATTCG
CGTTTCTCTGATGATGAGTGATACTGAGCACTTTTTCGTATGTGGGGAAATTTCATGTCTTTTGCTCCTTTTTCAATTAA
ATCATTTGTTTTATTGAGTTGTTTGAGCTTCTTATACTTCTAGTTATTAATCCCGTCTCAGATGCATAGTTTGCACATAT
TTGCTCCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCGGTGCAGAAGTTGCTTAGTTTGAGGTAATC
CCAATGGTCTATTTTTGCTTCGATTACTTGTGTTTTGAAGGTTTAAAACAAAATGTCTTCCTTCAGACAAATGTACTGGA
GCATTTCCCCAATATTTTCTTCTACGTGTTTCACAGGTTCAGGCCTTAGACTCACATCTTTAATCCACTTTCATTTGATT
TTTGTGTATGGTGACAGGTAGAGGTGCAGTTTCATTCCTCTGCATGTAGATGTCCAGGTTTCCCTGCACTGTTTATTGAA
AAAACTGTCCTTTCCTGATTGTGAGTTCTTGGCACCTTTGTCAAAGTCCATTGGATGGGCTGGGCATGGTGGCTAACACC
AGCAACTTCAGCACTTTGGGAGGCCAAGGCTGGTGGATCACCTGAGGACAGGAGTACAAGATTACTCTGGCCGACGTGAT
GAAACCTCGTCTCCACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCACCTGTAATACTACTACTCAGGAGTTTG
AGGCAAGAGAATTGATTGAACCCAGGAGGCTGAGGTTGCAGTGAACCGAGATTGCACCTCTGCACTCCAGCCTGGGTGAC
AGAGCGAGACTCCATCTCAAAAGAAAAAATAAAAAAAATTGGATGTAAATGCATGGATTATATCTGTGTTCTTCATTCTG
CTCCGTTGTTCTATGTGCCTTTCTTCATGCCAACATCATGCTGTTTTGCTTACTACAGCTCTGTAACATATTTTGAGATC
AGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTGAAGTCTCAAGACAGTGGGCGTCACATACAAAAATTATGGAAGA
AAGGATCCCTGGACTCCCAGGGCCCAATGTTAGATAACAGAGTGTTGGCCATGAACCAAACTCAAAGATTTCCACTGAGT
AGAGGACAGACACCCTCATTTCCTCACCTCTCTCCTGTCTCATGTTCTAGGAAACCCTTCAAATAGTTGGCCTTCACCCA
CTGAACCAAGCTCCAAAACCGGTGAGTACAGGACCCTCTTATATCCGCTTTTGGAACCCTGGGGAGGTGGAAACCTTGGA
TTCAGGCGTTGACTCAGCATCTCACAGCTCTGACATTGTACGCCTGTCTTCTACCATCTCCGAACTCCAGATACTCCAAC
AGCGAAAGGGATCTGGGCCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTCATTTTATGGAGCTGAGACCTCCTACAA
GCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAACGCAATGTTTGTTCTGCTTGCATTCCTAACTGGAGGA
TAAATTCCTGGGGGCTTGAGAGAGGGAAGGGAAGCGAACATCTGATGAGGGCGAGGTGTTTTAGAGAAGTTCCACTTGCC
AAGGAATGAGCTCCTGTTGGTCATGAAACAACCCTGGCTGACTCAGCAGAGCAAGAGCCTTGCCGTAACAGAGAACAGAG
CTCATGCACGCACACTTTGACTCACTGACTTATTCAGCCACGGCCCCATGCTCAGGTTGTGCAGTGTGGAAGCTTTTCCT
ATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTATTTAATTATCTTACAGTGCTCTAGCTC
AAAGCATGAAGTGCATCTCACTGGGCTAAAATCAAGATGACAGCAAGCCTGCCTTCCCTCTGAGGATTCCAGGCAAGAAT
CTGCTTCTCACTTGTCCCATCTTATAAAGGCTCCCAGTTCCTTGGCTGCTGGTCCCTTTCCTCCTTCCTCAAAACCCACA
AAGACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACCTCTTTCTCTGAATGCTGCTCTCCCTT
CTTCCTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCGTCATAATCTCCCGGAAATCATTC
AGGATACCCTTGTTTTAAGTTCAGCTGATTAGCAACCATAATTCCATCTGCAATCTTCATTCCTCCTTTCCATGTAAAAT
AACATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGCATTCTCCTGCCTTCCACAAATGGTGA
ACAAGATGCATTTGGCCTCTGCTCTTGGGACACTGATATTGCAGATGGTTAAATGGGAGGACAGAAAATGAATGCACAAG
TGGACCAATAAATGAATGATCCATTGGGAAGCATCTGTGCATGAAATCTATTTGTTTGTTCGTTCGTTTGTTTATTGAGA
CAGAGTCTCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCACTGCAACCTGCGTCTCCTGGATCCAAG
TGATTCTCCTGCCTCACCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCATGCCCGGCTAATTCTTTTTGTATATT
TTTTGTAGAGAGGATGTTTCACCATGTTGGCCAAGCTTGTCTGAAACTCCCAACCTCAAGTGATCCGACCATCTCAGCAA
CCCAAAGTACTGGGATTACAGGCGTGAGCCACTTTGCCCAGCCAGAATTCAAAATAAATAATAGATAATGCTGAGTGTAT
AATTTTGGGTGACAGAGAAGGTCTCACTAATCAGATATTTGTGACATTAATGAAAAACACGGATTGAACCCCTGAAAGAT
TGGCGGAAGGATTTTCCACACACAGCTGTCAGCTGTGAAGGCACAAAGGTGAAAACAATCTGATGTTGAAGGAAGAGGCT
CTGCCTGAAATGCTGGGAATGAGGTGGGGAGAATGACAAGATGACTGTAGAGAGATGGAGAGCACTCTGGGTACACAGGA
AACTAAGGAGGAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACCTCGGGGTAACCAGGAATCCCTACATG
ATTAATAGTGACTGACAAGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCTAGGAGACTGTGGAAAAGGCAATTGCC
GCCCCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGATGGATATAAGATATGCTTGTGAGGTAGA
ATCATTGGCTGGAAAGGCTTGCTGGGTTTGATTTTCCTACTTGTTTAATCCTCGCTTAATTAATTTCTTTCTGAGATTTA
TTCATCCTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGGTGGTGGAAATGAAGGGACCTATTATA
GCATAATATACAAGTCTGTGAACGGTGGCTCATGCTTGTAACCCAGCCCTGCAGGAGGCCAAGGCGGGTGGATTCCATGA
AGTCAGGAGTTCCAGACCAGCCTGGCCAACATGGTGAAACCCTATCTGTACTAAAAATACAAAAATTAGCCGAGCATGGT
GGTGCATCCCTGTAATCCCAGCTCCTACTCTGGAGGATGAAGCAGGAGAATGACTTCAACCCAGGAGGTGGAGGTTGCAG
TGAGTGGAGATTGCATCACTGCACTCCAGCCTGGGTGACACAAGGAGACTCCGTCTCAAAAAATAAAAATAAGAAATGCA
TAAATATAATAAAACACACACGAATGACAAAGGCACCTGAATTCCAATCATCATTTTTCTATTTCTCTATAATTACTTCT
TTGATCCTTTATCTTATCCATTAGGCAATGAGCCTAAAACCTCTTCCCTATTTGGCTTTCTGTGAGCATGAGATCACATA
GAAAATGTGAAAGCCCGCTGAATCCTCCAGCACGGATCCTGGAATAGAGAAAGTGCTCTGGTCATCGCAAAAAAAAACTT
GCCCACTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCACCTGTGGAGATTCAGATAGACCATGGGGAGGAAACAT
TAATACTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATCAGCGACAGCACTAGCTCCTGTTCCCCTTTCCTACTAAT
TCACAGGAGGACAGGTGGTATTGAAGCAATAGATGGTCGAGGGGGTGGTCCTTCCCCCAGCCTCTCGGGTAGAACAGCAG
CCTAACATGTGTCTCCCGAGATCACAAAGAGTAGCACATTTCACACGGGCTTCAACACTATTTCCTGGCTGTTTGACATA
AGAGAATCTTGCTTCGCTATTTTTAATCGTGATTTCACCTTTGTTTCCTTTCCTTGGTGAATGCAATTTGTTTGACTCAA
GAATGCTGTGGATGTAGAAATCCTAAAGCACATTCGCTGTGTATCAATCCCAGTGCAGTCTTCCCAGAGAAGACTCTAAA
CAAATCCTGGACTGCACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAATA
CGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTGCATTTCAATGTGAGCCAGTCCCT
CAAGGCTCAGAAAAGCTGCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAGCTGCGGGAAGCCAGAAAGCAGCCCAG
CCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAG
ACAGCCCAGGCTGTTCTGAGACATTCCTCCTGATCTCAGGATGTTGCTATCTTAGTCCATTTTTGTTGCTCTAAAGGAAC
ACTTGAGCCTGGGTAACTTCTAAAGAAAAGAGATTGGTTTGCCTCACAGTTCTGCAGGCTGTACTGGAAGCATGGCACCA
GAATCTATTTCTCGTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCGCAG
AGATCACACGGCAAGAGAGAGAGTAAGGGGGAGAGGGAGCGATGGAGCTTCCAAGCTCTTTTTAACAACCAGCTCTCCAG
GAACTAACAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGATCTGTTCATGATGGATCCACCTCCATGAC
CCAAACACCTCTGAAGAGGCCCAACCTCCCACAATGGGGGTGAAATTTCAATGTGAGGTTTGAAAGGGTCAAACATCTCA
ACTAAAGTAGTTGTATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAATTGAGAAAGCAGGGGAAAGCTAGGTCTC
CCGCCATTTGGGTGCTTGTCCTAAAGAGACGTTGTATGTGGTTACCTGCCAATCAAGAAATGCGAGACAATTCATAAAGA
GGAACTGCTATGATTAGCTTCTTATTGGTGTCTCCTCTTCTTCCAGGTAACCCCAGACACCTACATGTTCTGATTGGGAC
CTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCTCCGACAAAAAAAGTAAGTCTC
ACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCACGCGGATGTGTGTTCCTCACCAGCAGG
ATGGTCCCTGGCCCAAGACAGGAGCCACAGAGGCAGGACTTTCTAGAGAGAGCACCAGATTCCCTTCCCCTGCCTTCAGC
TCACAGACCATTGCCTGATTCTGAACTGTATCCTCACGTCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGACAG
GCAGAAAGTGGGAGATAGAATCAATGGGATGGGACCTCAGAGCTATTCATGGGATGGGTCCTTGAACTCAGAGAGATAGA
ATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGGCACCTATGGCCTCCCCCTGTTTGTTGGTATCTGCTTATGAAA
TGAGGACCCAGAAGTGCCCTCCGAGCTCTTTTGTTGACTTCCGTCTTCTACAGATGCTGCTGTAATGGACCAAGAGCCTG
CAGGGAACAGAACAGTGAACAGCGAGGTAGGTGCTCCTCCGCCCAGCCTCGTGGCTAGTCTTATTCCCAAAGAGTCCTGA
AAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGATTCTGATGAACAAGACCATCAGGAGGTGTCATAC
GCATAATTGGATCACTGTGTTTTCACACAGAGAAAAATCACTCGCCCTTCTGAGAGGCCCAAGACACCCCCAACAGATAC
CAGCATGTACATAGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTTCTGTCCACGAGCACCACAGTCAGGCCTTG
AGGGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATGTACCAGCAGCTGGAATCTGAAG
GCATCAGTCTTCATCTTAGGGCATCGCTCTTCCTCACACCACGAATCTGAACATGCCTCTCTCTTGCTTACAAATGTCTA
AGGTCCCCACTGCCTGCTGGAGAGAAAACACACTCCTTTGCTTAGCCCACAATTCTCCATTTCACTTGACCCCTGCCCAC
CTCTCCAACCTAACTGGCTTACTTCCTAGTCTACCTGAGGCTGCAATCACACTGAGGAACTCACAATTCCAAACATACAA
GAGGCTGCCTCTTAACACAGCACTTAGACACGTGCTGTTCCACCTCCCTTCAGACTATCTTTCAGCCTTCTGCCAGCAGT
AAAACTTATAAATTTTTTAAATAATTTCAATGTAGTTTTCCCGCCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR