Allele Report for 2DS4*0030101


2DS4*0030101
Previous Designations & Local Names: KIR1D
IPD Acc No: KIR00048
Assigned: 28-JUN-2003 Sequence Last Modified: 24-JAN-2005
Source Entries: AC011501 , AJ417554 , EU143323  
Cells Sequence Derived From: BELNK1 , RDP16 , UV5HL9-5B  
Known Ethnic Origin Of Source: Caucasoid
Publications
Maxwell LD et al. Tissue Antigens 60:254-8 2002. abstract
Martin AM et al. Immunogenetics 51:268-80 2000. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
Protein Sequence (240 aa)
MSLMVIIMACVGFFLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHREGKFNNTLHLIGEHHDGV
SKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDMVIIGLYEKPSLSAQPGPTVQAGENVTLSCSSIYPGKGRPM
NVGSLQCAASTEHSRPTFLWALPPTEGPTDASALSVTLPTSGQTRVIHCLFPSQETLQIVGLHPLNQAPKPVTPDTYMFX
Nucleotide Sequence Data (893 bps)
ATGTCGCTCATGGTCATCATCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACAGGAGGGAGTCCACAG
AAAACCTTCCTTCCTGGCCCTCCCAGGTCACCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCGGATGTCA
TGTTTGAGCACTTCCTTCTGCACAGAGAGGGGAAGTTTAACAACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTT
TCCAAGGCCAACTTCTCCATTGGTCCCATGATGCCTGTCCTTGCAGGAACCTACAGATGCTACGGTTCTGTTCCTCACTC
CCCCTATCAGTTGTCAGCTCCCAGTGACCCTCTGGACATGGTGATCATAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCATCTATCCAGGGAAGGGGAGGCCCATG
AACGTAGGCTCCCTGCAGTGCGCAGCATCAACGGAACATTCCAGGCCGACTTTCCTCTGGGCCCTGCCACCCACGGAGGG
ACCTACAGATGCTTCGGCTCTTTCCGTGACGCTCCCTACGAGTGGTCAAACTCGAGTGATCCACTGCTTGTTTCCGTCAC
AGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTAACCCCAGACACCTACATGTTCTGA
TTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCTCCGACAAAAAAAAT
GCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGATTCTGATGAACAAGACCATCAGGAGGT
GTCATACGCATAA
Genomic Sequence Data (15581 bps)
GTTTGGGAGGTTGGATCTAAGACATGTTTTGAGTTGGTCATAGTGAAGGACGCGAGGTGTCAATTCTAGTGAGAGCAATT
TCCAGGAAGCCATGTTCTGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAAAGCCTGCGTACGTCACCCT
CCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCG
CGGCCGCCTGTCTGCACCGGCAGCACCATGTCGCTCATGGTCATCATCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAAT
AGAGGGAGGGAGCGTGGGGATGGAGATCTGGGCCCAGAGGTGGAGATATGGGCCTGGAGGTGGAGTTATGGGCCTGGAGT
GGAGATCTGGGCCTAGAGATGGAGTGATGAGCCTAGAAGTGGAGATCTGCGCCTGGAGTGGAGATCTGGGCCTGGAGTGA
AGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGGGATAGGAACCTGGAGTGGAGAGAGGAACCTGGAGGAGAGAT
AGGAACCTGGAGGGGAGGTAGGAGCCTAGGGTGGAGATATGGGACTGGAGTGGAGATATGGGACTGGAGTGGAGATATGG
GCCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTATGGGCCTGGAGGTGGAGATACGGGCCTGGAGTGGAGATATGAGCC
TGGAGTGGAGATATGGTCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGCAGTGGAGTTATGGGCCTGGA
GTGAAGTTATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGATATGGGACTAGAGTGGAGATAGGGGCCTGGAGGT
GGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAG
ATATGGGTCTGCAGTGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTA
TGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGATATGGGACTAGAGTGGAGATAGGGGCCTGGAGGTGGAGATCTG
GGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGAGCCTGGAGTGGAGATATGGCCC
TGGAGTGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTATGGGCCTGG
AGGTGGAGATATGGGCCTGGAGTGGAGATATGGGACTAGAGTGGAGATACGGGCCTGGAGGTGGAGATCTGGGCCTGGAG
TGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGAGCCTGGAGTGGAGATATGGCCCTGGAGTGGA
GATATGGGCCTGGAGTGGAGATATGAGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATA
TGGGCCTGGAGTGGACATATGGGTCTGGAGTGGAGATACGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGATATGG
GCCTGGAGGTGGTGATATGGGCCTGGAGTGTAGACATGGGCCGAGTGGAGATATGGGTCTGGAGTGGAGATATGGGCCTG
GAGTGGAGATATGGGACTGGAGTGGAGATATAGGCATGGGGTGGAGACATGGGCCGGGAGTGGAGATATGGGACTGGAGT
GGAGATACGGGCGTGGGGTGGAGATATGTGCCTGGAGGTGGAGATATGGGCGTGGGTTGGAGATATGGGCCTGGAGTGGA
GATATGGGCGTGGGGTGGAGATATGGATCTGGAGTGGAGACATGGGCATGGGGTGGAGATATGGGCCTGGTGTGTAGATA
TGGGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATCTGGGCCTACGGTGGAGATATGGG
CCTAGGATGGGGATATGGGCCTGGAATGGAGATATGGGCCTGGGTGTGGAGATATGGGACTGGAGTGGAGATATGGGCCT
GATGTGGAGATATGGGCTTGGAGTGGAGATATGATCCTGGAGTGTAGTTATGGGCCTGGAGGTGGAGATCTGGGCCTGGG
GTGGAGATATGGGCCTGGAGTGGAGATATGGGACTGGAGAGGAGATATGGGACTGGAGTGGAGATATGGGCCTGGAGTGG
AGATATGGGCCTGGATTGGAGATATGGGCCGAGGGTGGAGATCTGAGCCTGGATTGGAGATGTGGGCCCGGATTGGCTAT
ATGGGTCTAGGGTGGAAATATCGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCTTGGGGTGGGGATATGG
GCCTGGAGGCTGGGTCTCTGCACAGCCGAGAGCACTGTTCTTGGGTGCAGGTAGGCTCTGATGGTGAGTTTCCCTTCGGC
CCAGGAAGGGGCTGGCTATCAAGACTCACAGCCCAGTGGGGGCAGCAAGGAAGGCCTTGTTTGCCTGCAAATGGATCTTC
CATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACAGGAGGGTAAGTCCTTCTCCAAACCTTAG
GGTGTCATCTCCCCACATAAGAGGATTTTCCTGAAACGGGAGGGAAGTCCTGTCAGGGAGTCTCTCATAAACTAGGAAGA
GGGGACCCTGGGGTGCTCGGCCCACAGTTCCGACCTTGCCTCCCTGGCCTCTCAACCCCTTGGCAGAGTCAAGTTGTGTG
GGGACCAGGGTTGGACTAGGGTGTTCAAAGCTGGGTTGTGTGGTGGGGAAGTGGTAGGAACAGCAGATCCTCTGAGGACA
AAGGTGTTACTCACACACTTCAGCGTTTCCATGACGGTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCAGAAGAGGTG
GGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGATGGGGGCTAAGTTTTTTATTTTCATTCAGGCAACTGCTGA
TATTCCATTCTCAAAGGACATGCCCTCCACTTCATGTCTACCCTGTGTTGTTTTATGTCAGTAATCTTACAGTATTAAAA
TCTAGTAGGAGTCTCTTACTCAGCACTTGCTCAAAGTTCTCAGCTGACACTTTTGTTGTACGGAGACACCTTGTCTTTGT
GGGATGGGTCCTTCCTTTAGCCCTAGGCACCAAGGTGTGATAGCAGCCATAGAAATGTGGAAAGTGGGGAGAATCTTCTG
AGCACAGGGAGGGAGGCACAGCTCCACATCCTCCTCTCTAAGGCGGCGCCTCCTTCACCCCAAGGTGGTCAGGACAAGCC
CTTGCTTTCTACCTGGCCCAGCCTTGTGGTGCCTCCAGAACATGTGACTCTTCAGTGTCACTCTAATCTTGGGTTTAACA
ACTTCAGTCTGTACAAGGATGATGGGGTGCCTGTCCCTGAGCTGTACAACAGAATATTCTGGAAAAGCCTTTTCATGGGC
CCTGTGACCACGTCACATGCAGGGACCTATAGATGCCGGGGTTCACACACACACTCCCCCAGTGGGTGGTCGGCACCCAG
CAACCCCCTGGTGATCGTGGTCACAGGTCAGAGGGCTCCTGTCTGGGATTCTCCTTGTCCCACCTCCTGAATCCCAGAGC
TTCTGGTAGGCATGTCCTTGAGGGTCCCATCACGCAGGCCCTAACTGTATTTGGGGTAAAGGGGGATTGAATACAGGGAA
ATGGGTGCTGTGGTGGGAAGAATAAGTGTCCCCAGTGATGACTGCATTCTAATCCCTGGAGTCTGTGACTATTTATGTTA
TAGGGGAAGGGACTGAAGGGGAAGATGGAGCTCAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGACAGCCTGGACTGT
CCCGGTGGGCTCAGTATAATCACAAGTGTCCACATGAAAGGAGGAGGAAGAGGAGAGTGGGGATTAGAGCAGCGTAGTGG
GAGACTCCATCAGCTTTGAAGGTGGATGAAGGCCATAAGCCATGAATGCAGGTGGCCTATAGAGGCTGGGAAAGTCAAGT
AACTGATTCTCCTGAGTCTCCAGAGGGAACACAGCCCTGCAGATGCCTTGATTTTAGCCCTCGAAAAACAGGGTCCGCTT
TCTGTCTCCAGAATCGGAGGGGGTCAGTGTGCTCTCTCCTGCTGCCATGCTTCTGATAATTTTCTACAGCAGCAACAGGA
AACCAACACTGGAACCCAGGTCAAGGACAAGTTAAGAAAAGACACAAGGATAGCCAGGCATGGTGGCAGGTGCATGTAAT
CCTAGCGACTCGGGAGGCTGAGAGCAGGAGAATCGCTTGAACCCAGGAGACAGAGGTTGCAGTGAGCGTAGACCACACCA
CTTCACTCCAGCCTGGGTGAAGGAGTGAGACTCTGTCTCCAAAATTAATTAATTAATTAAAGAAACCAAACAAAGAGAAG
GTTGGCTACACCGAGATCAGCAAGGGTGGGATGATGATGCCACCACCAGGCTCCATCCACATAGGGAGGGGTTGATACTC
CTCAAATCAGCACGAGGAGCCAGCCTATGGAAACTGGCACCATGGAGAAGGCACAGACATGGCAAGAGTGGCTCCCAGTC
CCCACCAGGAACAGGGTGTGTGGACACTGGTGCCTGCCTTACTGATCAGTTCATACCTCCTGCCAAGGATTCCAATTCGT
CCAAAAGAGATTGAACCAAGCTGCTAAGAGCCGGGACGTGCAGCCTATCCTGCTTCCTCTTCCACTCCCACATAGACAGT
AAGAAAGACATTAGTGTGAAATAGATACAACAGCCCAAGAGATGAGGCTGAGCCCAGTGGGAAGGGAATCACAGCTACTA
GAGACAGAGGGACAGAGAAGAGGGAGGGAGACAGATGGAAGGACCTGCACCAGGAGTTATGGGCACAGAAAAGAACATGA
AGACACAGAGAGGAAGCAGAGAGACAGACACCAGCGAAGGGAAGGCTCACTCATTCCAGGTGCCATGGATGGGATGATAA
AGAGAGACACCTTCTAAACTCACAACCTCTCTTCCTAGGAGTCCACAGAAAACCTTCCTTCCTGGCCCTCCCAGGTCACC
TGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCGGATGTCATGTTTGAGCACTTCCTTCTGCACAGAGAGGGG
AAGTTTAACAACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTTTCCAAGGCCAACTTCTCCATTGGTCCCATGAT
GCCTGTCCTTGCAGGAACCTACAGATGCTACGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCTC
TGGACATGGTGATCATAGGTGAGAGTGTCCAGACATTCTTCTCATTGTCATTGGGATGCAGAGTGAATGATCCAGGACTT
GGAGACCCAGGTGGTTGTAAGGAAGATGAGCTTGGTATTCTTATGGAGAGAGACTGACTTGGTGAGGTCTGTGCCAACAG
AGACAGAGAAACAAGAGACACAAGTACAGACCAGGTGTCATAACAGAGGACAAACACAGGGGCCATACAGGGAGTTAGAA
AAGACAGAAAGAGTTAAAGGAGACAGACAGACATGTCCCAGACAGAGGTGTCCTTCCATGCTGACTTTGCTCAGAGACCT
GGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTGTTCTCTACCAGGAGAACCCAAGGACACCCATATTTC
TGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCACCTACAGATGCCATGCTTATTCTGACACCTCTGACTTCCAT
GCAATGGAGAATAATCGTCCCAAAATATCATGGCCCCAGAACACCAACCCCTGTATGCTGTGTGAACTTGTGGTCTCCAG
ACTGGATTCTGAGGCTCACATTCCAAATAACCCCACATATCACATATGAGAGGATCACTGAGAAGCACAGAGAGAAATCA
GGGACACCAAAAAGCAAAGACATAAACACACAGAGAAAGAGCCAGAGGAAGGAGATTGAGAGACTCACAGACACATAAAG
AGAGAGAAGAGGGCAGAGAAGTGGAGAGAATGATGGAAGAGAGCAGAGAAAACCACTAAAATTAGAGTCCTGAGGGCGAG
GCACAAGGGCATAGAAAGATGGAGATGTGGGGATGAATTGCAGAGATTCCAAAGAGAACTAGAGAGACCGAGAGGCAGAG
CAAGACAGATGATAGATGGATAGATACAGATAGATGATGGATAGATATAGATAGATGATATATAGGTAGATGATAGATAA
TAGGTTATAGATACATAGATGATGATTGATTGATTCATTAATAGATGATACATAGAGATGATGATGATGAAGATAGATGG
ATAGATAATACATAGAGATAGAGAGGAAGACAAAGAGAGAAATAATAGAGAGAGAGAGATGATACATATATATAGATAAT
AGATGATTGACGGATAGACAATTGATAGATAAATAGATGATATATAGATATAGATGACAGGTAGAGAATTTGTAGATAGG
CACCGAATAGATAAATAGATGGATTGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACGGGACACAAACTGAGAA
ACTCAGAGTTAAAAAAAGTAACATCAAGTCAACCAATCCAAGGAGAGCCAGAGAGAATAAAACAATCCAAAAACGGAAAA
CATAACTAGAGGTAGGGAAGTGAGGTCAGAGACCTACAGAGACAGAGAAGGTGGAAGGAGGAAATAGACATGAAGAGAGA
TAGGGTGGAGGGTGAGACAGAGAAAGAGAGCATTAGGCCATAGAGCAGGGGAGTGAGTTCTCAGGTCAGGTGTGAGGGGA
GCTGTGACAAGGAAGATCCCCCCTGAGGAAACTGCCCCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCATCTATCCAGGGAAGGGGAGGCCCATG
AACGTAGGCTCCCTGCAGTGCGCAGCATCAACGGAACATTCCAGGCCGACTTTCCTCTGGGCCCTGCCACCCACGGAGGG
ACCTACAGATGCTTCGGCTCTTTCCGTGACGCTCCCTACGAGTGGTCAAACTCGAGTGATCCACTGCTTGTTTCCGTCAC
AGGTGAGGAAACCCCATATCTGTCCCATGTCCTATGATCCTAGAGCCTTAGCTGAGGAGCTTCCTGCTGATGATGGAGAG
AAGCATGGACAGATGCAGAGAGAAGACGCAGCATGCCTGTGAGGGAGGGATCAGGGCGCAGGATGGCACACACAGCACCT
CCAAACCCTCCTGCATGGCCTGCATGGAGGCCTCCGATTAGGGCTCCAGAAACCCAGGCAGATGTAGAAAGCGGTCAGGA
GAGACCCAGAGAAGGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGTTCCCTCAGCCCCTCAACCTTACCCATTTCCCA
GAAGCCCTTCCTGGCCTCTCACCCACACAGAGATGTCATCACCAGCAACCCCTACATCCTTTTCTTTTTGTTTGAAAAAA
TATTCATTGAGGTTAAATATACCTATATAGCTTACCACTTTTAACATTTTTTTTTTTTTGAGGTGGAGTCTAGCTCTGTC
TCCTATGCTGGAATGCAGTGGCACAATCTCAGCTCACTGTAACCTCCGCCTCCTGGGTTCAAGCGATTCTCCTGCCTCAG
CCACCTGAGTAGCTGGTACTACAGGCGCCCATCACCACGCCGGGCTACTTTTTGTATTTTTAGTAGAGAGGGGGTTTCAC
CATGTTGGTCGAGCTGCTCTGGAACTCCTGACCACGTGATCCACCCGCCTCAGGCTCCCAAAGTGCTGGGATTACAGGCA
TGAGCCACCGCGCCCGGCCACGTTTACCAATTTTAAGTGTAAGGTCTAGTGGTCATAAATACATACATATAAATTTTTTG
TTTGTTTGTTTTATCCTCCACCCTTTTCTTCCTGGCCTCTGGTAGCCACCATTCTACTCTCTATCTTCATGAGATCCACC
TTTTAGCTCCTGTATATGGGTGAGAAATGAGAATATTTGTAATGACTTCCAGTTCCATCCATGTGGCTGCAAATATCAGG
ATGTTATTCTTTCTATGGATGAGTAGTCTCCGCTGTGCGTATGTACTACATTCTCTCTATCCATTCATCCACTGATGGGC
AGGTAGGTTGACTCCACATCTTGGCTACTGTGAAGAGTGCTGCACCAATCATACGAGTGCAGATATCACTTCGATACATT
GATTTACTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGATACTATGAAAGTTCTCTTTTTAGTTTTTCGTTTGT
TGTTTTGTTTTTGTTTTTGAGACAGTTTCCCTCTGTGCCCAGGCTGGAGTACAAGTGATGTGATCTTGGCTCATTGCAAC
CTCCGCCTCCTGGGTTCAAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCTGGGATTACAGGTGCACGCCACCATGCCGG
GATACTTTTTGGTTTTTTTTAGTGTACATGGGGTTTCCCCAGGTTGGCTAGGCTGCTCTCAAACTCATGACCTCAACTGA
GGTGCCCGCCTCGGTCTCCCAAAGTGCCGGGATTACAGGCATGATCCACTTCATCCAACCTCTTTTTAGTTCTTTAAAGG
ACTTCCATACTTTTCTCCGTAATGGCTGTACTAATTTACACTCCTACCAACAGGGTACCAGGGTTCTCCTTTCTCTACCA
CCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTTATTTCATTTTATTTTGAGATGGAGTTTCG
CTCTTGTCACCCAGGCTGGAGTGCAGTGGTGCGATCTCGGCTCACCGCAACCTCCACCTCCCAGGTTCAAGCGATTCTCC
TGCCTCAGCCTCCCGAGTAGCTGGAATTACAGGCACACGCCACCACGCCCGACTAATTTTTGTATTTTTAGTAGAGACAG
CGTTTCTCCATGTGGGTCAGACTGGTCTCAAACTCCCGACCTTATGAGATTCGCCCACCTCGGGCTCTCAGAGTTCTAGG
ATGACAGACGTGAGCCACCTCGCCCGGCCTAAAAGCCATTTTAATGGGGTGAGATGAAAACTCACTTTGATTTTAATTCG
CGTTTCTCTGATGATGAGTGATACTGAGCACTTTTTCGTATGTGGGGAAATTTCATGTCTTTTGCTCCTTTTTCAATTAA
ATCATTTGTTTTATTGAGTTGTTTGAGCTTCTTATACTTCTAGTTATTAATCCCGTCTCAGATGCATAGTTTGCACATAT
TTGCTCCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCGGTGCAGAAGTTGCTTAGTTTGAGGTAATC
CCAATGGTCTATTTTTGCTTCGATTACTTGTGTTTTGAAGGTTTAAAACAAAATGTCTTCCTTCAGACAAATGTACTGGA
GCATTTCCCCAATATTTTCTTCTACGTGTTTCACAGGTTCAGGCCTTAGACTCACATCTTTAATCCACTTTCATTTGATT
TTTGTGTATGGTGACAGGTAGAGGTGCAGTTTCATTCCTCTGCATGTAGATGTCCAGGTTTCCCTGCACTGTTTATTGAA
AAAACTGTCCTTTCCTGATTGTGAGTTCTTGGCACCTTTGTCAAAGTCCATTGGATGGGCTGGGCATGGTGGCTAACACC
AGCAACTTCAGCACTTTGGGAGGCCAAGGCTGGTGGATCACCTGAGGACAGGAGTACAAGATTACTCTGGCCGACGTGAT
GAAACCTCGTCTCCACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCACCTGTAATACTACTACTCAGGAGTTTG
AGGCAAGAGAATTGATTGAACCCAGGAGGCTGAGGTTGCAGTGAACCGAGATTGCACCTCTGCACTCCAGCCTGGGTGAC
AGAGCGAGACTCCATCTCAAAAGAAAAAATAAAAAAAATTGGATGTAAATGCATGGATTATATCTGTGTTCTTCATTCTG
CTCCGTTGTTCTATGTGCCTTTCTTCATGCCAACATCATGCTGTTTTGCTTACTACAGCTCTGTAACATATTTTGAGATC
AGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTGAAGTCTCAAGACAGTGGGCGTCACATACAAAAATTATGGAAGA
AAGGATCCCTGGACTCCCAGGGCCCAATGTTAGATAACAGAGTGTTGGCCATGAACCAAACTCAAAGATTTCCACTGAGT
AGAGGACAGACACCCTCATTTCCTCACCTCTCTCCTGTCTCATGTTCTAGGAAACCCTTCAAATAGTTGGCCTTCACCCA
CTGAACCAAGCTCCAAAACCGGTGAGTACAGGACCCTCTTATATCCGCTTTTGGAACCCTGGGGAGGTGGAAACCTTGGA
TTCAGGCGTTGACTCAGCATCTCACAGCTCTGACATTGTACGCCTGTCTTCTACCATCTCCGAACTCCAGATACTCCAAC
AGCGAAAGGGATCTGGGCCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTCATTTTATGGAGCTGAGACCTCCTACAA
GCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAACGCAATGTTTGTTCTGCTTGCATTCCTAACTGGAGGA
TAAATTCCTGGGGGCTTGAGAGAGGGAAGGGAAGCGAACATCTGATGAGGGCGAGGTGTTTTAGAGAAGTTCCACTTGCC
AAGGAATGAGCTCCTGTTGGTCATGAAACAACCCTGGCTGACTCAGCAGAGCAAGAGCCTTGCCGTAACAGAGAACAGAG
CTCATGCACGCACACTTTGACTCACTGACTTATTCAGCCACGGCCCCATGCTCAGGTTGTGCAGTGTGGAAGCTTTTCCT
ATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTATTTAATTATCTTACAGTGCTCTAGCTC
AAAGCATGAAGTGCATCTCACTGGGCTAAAATCAAGATGACAGCAAGCCTGCCTTCCCTCTGAGGATTCCAGGCAAGAAT
CTGCTTCTCACTTGTCCCATCTTATAAAGGCTCCCAGTTCCTTGGCTGCTGGTCCCTTTCCTCCTTCCTCAAAACCCACA
AAGACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACCTCTTTCTCTGAATGCTGCTCTCCCTT
CTTCCTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCGTCATAATCTCCCGGAAATCATTC
AGGATACCCTTGTTTTAAGTTCAGCTGATTAGCAACCATAATTCCATCTGCAATCTTCATTCCTCCTTTCCATGTAAAAT
AACATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGCATTCTCCTGCCTTCCACAAATGGTGA
ACAAGATGCATTTGGCCTCTGCTCTTGGGACACTGATATTGCAGATGGTTAAATGGGAGGACAGAAAATGAATGCACAAG
TGGACCAATAAATGAATGATCCATTGGGAAGCATCTGTGCATGAAATCTATTTGTTTGTTCGTTCGTTTGTTTATTGAGA
CAGAGTCTCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCACTGCAACCTGCGTCTCCTGGATCCAAG
TGATTCTCCTGCCTCACCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCATGCCCGGCTAATTCTTTTTGTATATT
TTTTGTAGAGAGGATGTTTCACCATGTTGGCCAAGCTTGTCTGAAACTCCCAACCTCAAGTGATCCGACCATCTCAGCAA
CCCAAAGTACTGGGATTACAGGCGTGAGCCACTTTGCCCAGCCAGAATTCAAAATAAATAATAGATAATGCTGAGTGTAT
AATTTTGGGTGACAGAGAAGGTCTCACTAATCAGATATTTGTGACATTAATGAAAAACACGGATTGAACCCCTGAAAGAT
TGGCGGAAGGATTTTCCACACACAGCTGTCAGCTGTGAAGGCACAAAGGTGAAAACAATCTGATGTTGAAGGAAGAGGCT
CTGCCTGAAATGCTGGGAATGAGGTGGGGAGAATGACAAGATGACTGTAGAGAGATGGAGAGCACTCTGGGTACACAGGA
AACTAAGGAGGAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACCTCGGGGTAACCAGGAATCCCTACATG
ATTAATAGTGACTGACAAGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCTAGGAGACTGTGGAAAAGGCAATTGCC
GCCCCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGATGGATATAAGATATGCTTGTGAGGTAGA
ATCATTGGCTGGAAAGGCTTGCTGGGTTTGATTTTCCTACTTGTTTAATCCTCGCTTAATTAATTTCTTTCTGAGATTTA
TTCATCCTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGGTGGTGGAAATGAAGGGACCTATTATA
GCATAATATACAAGTCTGTGAACGGTGGCTCATGCTTGTAACCCAGCCCTGCAGGAGGCCAAGGCGGGTGGATTCCATGA
AGTCAGGAGTTCCAGACCAGCCTGGCCAACATGGTGAAACCCTATCTGTACTAAAAATACAAAAATTAGCCGAGCATGGT
GGTGCATCCCTGTAATCCCAGCTCCTACTCTGGAGGATGAAGCAGGAGAATGACTTCAACCCAGGAGGTGGAGGTTGCAG
TGAGTGGAGATTGCATCACTGCACTCCAGCCTGGGTGACACAAGGAGACTCCGTCTCAAAAAATAAAAATAAGAAATGCA
TAAATATAATAAAACACACACGAATGACAAAGGCACCTGAATTCCAATCATCATTTTTCTATTTCTCTATAATTACTTCT
TTGATCCTTTATCTTATCCATTAGGCAATGAGCCTAAAACCTCTTCCCTATTTGGCTTTCTGTGAGCATGAGATCACATA
GAAAATGTGAAAGCCCGCTGAATCCTCCAGCACGGATCCTGGAATAGAGAAAGTGCTCTGGTCATCGCAAAAAAAAACTT
GCCCACTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCACCTGTGGAGATTCAGATAGACCATGGGGAGGAAACAT
TAATACTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATCAGCGACAGCACTAGCTCCTGTTCCCCTTTCCTACTAAT
TCACAGGAGGACAGGTGGTATTGAAGCAATAGATGGTCGAGGGGGTGGTCCTTCCCCCAGCCTCTCGGGTAGAACAGCAG
CCTAACATGTGTCTCCCGAGATCACAAAGAGTAGCACATTTCACACGGGCTTCAACACTATTTCCTGGCTGTTTGACATA
AGAGAATCTTGCTTCGCTATTTTTAATCGTGATTTCACCTTTGTTTCCTTTCCTTGGTGAATGCAATTTGTTTGACTCAA
GAATGCTGTGGATGTAGAAATCCTAAAGCACATTCGCTGTGTATCAATCCCAGTGCAGTCTTCCCAGAGAAGACTCTAAA
CAAATCCTGGACTGCACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAATA
CGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTGCATTTCAATGTGAGCCAGTCCCT
CAAGGCTCAGAAAAGCTGCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAGCTGCGGGAAGCCAGAAAGCAGCCCAG
CCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCTCCTCCAGGAAGAACAGGAAG
ACAGCCCAGGCTGTTCTGAGACATTCCTCCTGATCTCAGGATGTTGCTATCTTAGTCCATTTTTGTTGCTCTAAAGGAAC
ACTTGAGCCTGGGTAACTTCTAAAGAAAAGAGATTGGTTTGCCTCACAGTTCTGCAGGCTGTACTGGAAGCATGGCACCA
GAATCTATTTCTCGTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCGCAG
AGATCACACGGCAAGAGAGAGAGTAAGGGGGAGAGGGAGCGATGGAGCTTCCAAGCTCTTTTTAACAACCAGCTCTCCAG
GAACTAACAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGATCTGTTCATGATGGATCCACCTCCATGAC
CCAAACACCTCTGAAGAGGCCCAACCTCCCACAATGGGGGTGAAATTTCAATGTGAGGTTTGAAAGGGTCAAACATCTCA
ACTAAAGTAGTTGTATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAATTGAGAAAGCAGGGGAAAGCTAGGTCTC
CCGCCATTTGGGTGCTTGTCCTAAAGAGACGTTGTATGTGGTTACCTGCCAATCAAGAAATGCGAGACAATTCATAAAGA
GGAACTGCTATGATTAGCTTCTTATTGGTGTCTCCTCTTCTTCCAGGTAACCCCAGACACCTACATGTTCTGATTGGGAC
CTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCTCCGACAAAAAAAGTAAGTCTC
ACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCACGCGGATGTGTGTTCCTCACCAGCAGG
ATGGTCCCTGGCCCAAGACAGGAGCCACAGAGGCAGGACTTTCTAGAGAGAGCACCAGATTCCCTTCCCCTGCCTTCAGC
TCACAGACCATTGCCTGATTCTGAACTGTATCCTCACGTCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGACAG
GCAGAAAGTGGGAGATAGAATCAATGGGATGGGACCTCAGAGCTATTCATGGGATGGGTCCTTGAACTCAGAGAGATAGA
ATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGGCACCTATGGCCTCCCCCTGTTTGTTGGTATCTGCTTATGAAA
TGAGGACCCAGAAGTGCCCTCCGAGCTCTTTTGTTGACTTCCGTCTTCTACAGATGCTGCTGTAATGGACCAAGAGCCTG
CAGGGAACAGAACAGTGAACAGCGAGGTAGGTGCTCCTCCGCCCAGCCTCGTGGCTAGTCTTATTCCCAAAGAGTCCTGA
AAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGATTCTGATGAACAAGACCATCAGGAGGTGTCATAC
GCATAATTGGATCACTGTGTTTTCACACAGAGAAAAATCACTCGCCCTTCTGAGAGGCCCAAGACACCCCCAACAGATAC
CAGCATGTACATAGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTTCTGTCCACGA

IPD-KIR