Allele Report for 2DS4*0010109


2DS4*0010109
Previous Designations & Local Names: GRC212_BA1
IPD Acc No: KIR00497
Assigned: 28-AUG-2009 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182353  
Cells Sequence Derived From: GRC-212  
Known Ethnic Origin Of Source: American Indian
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (304 aa)
MSLMVIIMACVGFFLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHREGKFNNTLHLIGEHHDGV
SKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDMVIIGLYEKPSLSAQPGPTVQAGENVTLSCSSRSSYDMYHL
SREGEAHERRLPAVRSINGTFQADFPLGPATHGGTYRCFGSFRDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA
Nucleotide Sequence Data (915 bps)
ATGTCGCTCATGGTCATCATCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACAGGAGGGAGTCCACAG
AAAACCTTCCTTCCTGGCCCTCCCAGGTCACCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCGGATGTCA
TGTTTGAGCACTTCCTTCTGCACAGAGAGGGGAAGTTTAACAACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTT
TCCAAGGCCAACTTCTCCATTGGTCCCATGATGCCTGTCCTTGCAGGAACCTACAGATGCTACGGTTCTGTTCCTCACTC
CCCCTATCAGTTGTCAGCTCCCAGTGACCCTCTGGACATGGTGATCATAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTA
TCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGTGCGCAGCATCAACGGAACATTCCAGGCCGACTTTCCTCT
GGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGACGCTCCCTACGAGTGGTCAAACTCGAGTG
ATCCACTGCTTGTTTCCGTCACAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTAAC
CCCAGACACCTACATGTTCTGATTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCG
CTGGTGCTCCGACAAAAAAAATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGATTCTG
ATGAACAAGACCATCAGGAGGTGTCATACGCATAA
Genomic Sequence Data (14656 bps)
GTTTGGGAGGTTGGATCTAAGACATGTTTTGAGTTGGTCATAGTGAAGGACGCGAGGTGTCAATTCTAGTGAGAGCAATT
TCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAAAGCCTGCGTACGTCACCCT
CCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGTGCTGCTGAGCTGAGCTGGGGCG
CGGCCGCCTGTCTGCACCGGCAGCACCATGTCGCTCATGGTCATCATCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAAT
AGAGGGAGGGAGCGTGGGGATGGAGATCTGGGCCCAGAGGTGGAGATATGGGCCTGGAGGTGGAGTTATGGGCCTGGAGT
GGAGATCTGGGCCTAGAGATGGAGTGATGAGCCTAGAAGTGGAGATCTGCGCCTGGAGTGGAGATCTGGGCCTGGAGTGA
AGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGGGATAGGAACCTGGAGTGGAGAGAGGAACCTGGAGGAGAGAT
AGGAACCTGGAGGGGAGGTAGGAGCCTAGGGTGGAGATATGGGACTGGAGTGGAGATATGGGACTGGAGTGGAGATATGG
GCCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTATGGGCCTGGAGGTGGAGATACGGGCCTGGAGTGGAGATATGAGCC
TGGAGTGGAGATATGGTCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGCAGTGGAGTTATGGGCCTGGA
GTGAAGTTATGGGCCTGGATTGGAGATATGGGCCGAGGGTGGAGATCTGAGCCTGGATTGGAGATGTGGGCCCGGATTGG
CTATATGGGTCTAGGGTGGAAATATCGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCTTGGGGTGGGGAT
ATGGGCCTGGAGGCTGGGTCTCTGTACAGCCGAGAGCACTGTTCTTGGGTGCAGGTAGGCACTGATGGTGAGTTTACCTT
CGGCCCAGGAAGGGGCTGGCTATCAAGACTCACAGCCCAGTGGGGGCAGCAAGGAAGGCCTTGTTTGCCTGCAAATGGAT
CTTCCATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACAGGAGGGTAAGTCCTTCTCCAAACC
TTAGGGTGTCATCTCCCCACATAAGAGGATTTTCCTGAAACGGGAGGGAAGTCCTGTCAGGGAGTCTCTCATAAACTAGG
AAGAGGGGACCCTGGGGTGCTCGGCCCACAGTTCCGACCTTGCCTCCCTGGCCTCTCAACCCCTTGGCAGAGTCAAGTTG
TGTGGGGACCAGGGTTGGACTAGGGTGTTCAAAGCTGGGTTGTGTGGTGGGGAAGTGGTAGGAACAGCAGATCCTCTGAG
GACAAAGGTGTTACTCACACACTTCAGCGTTTCCATGACGGTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCAGAAGA
GGTGGGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGATGGGGGCTAAGTTTTTTATTTTCATTCAGGCAACTG
CTGATATTCCATTCTCAAAGGACATGCCCTCCACTTCATGTCTACCCTGTGTTGTTTTATGTCAGTAATCTTACAGTATT
AAAATCTAGTAGGAGTCTCTTACTCAGCACTTGCTCAAAGTTCTCAGCTGACACTTTTGTTGTACGGAGACACCTTGTCT
TTGTGGGATGGGTCCTTCCTTTAGCCCTAGGCACCAAGGTGTGATAGCAGCCATAGAAATGTGGAAAGTGGGGAGAATCT
TCTGAGCACAGGGAGGGAGGCACAGCTCCACATCCTCCTCTCTAAGGCGGCGCCTCCTTCACCCCAAGGTGGTCAGGACA
AGCCCTTGCTTTCTACCTGGCCCAGCCTTGTGGTGCCTCCAGAACATGTGACTCTTCAGTGTCACTCTAATCTTGGGTTT
AACAACTTCAGTCTGTACAAGGATGATGGGGTGCCTGTCCCTGAGCTGTACAACAGAATATTCTGGAAAAGCCTTTTCAT
GGGCCCTGTGACCCCGTCACATGCAGGGACCTATAGATGCCGGGGTTCACACACACACTCCCCCAGTGGGTGGTCGGCAC
CCAGCAACCCCCTGGTGATCATGGTCACAGGTCAGAGGGCTCCTGTCTGGGATTCTCCTTGTCCCACCTCCTGAATCCCA
GAGCTTCTGGTAGGCATGTCCTTGAGGGTCCCATCACGCAGGCCCTAACTGTATTTGGGGTAAAGGGGGATTGAATACAG
GGAAATGGGTGCTGTGGTGGGAAGAATAAGTGTCCCCAGTGATGACTGCATTCTAATCCCTGGAGTCTGTGACTATTTAT
GTTATAGGGGAAGGGACTGAAGGGGAAGATGGAGCTCAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGACAGCCTGGA
CTGTCCCGGTGGGCTCAATATAATCACAAGTGTCCACATGAAAGGAGGAGGAAGAGGAGAGTGGGGATTAGAGCAGCGTA
GTGGGAGACTCCATTAGCTTTGAAGGTGGATGAAGGCCATAAGCCATGAATGCAGGTGGCCTATAGAGGCTGGGAAAGTC
AAGTAACTGATTCTCCTGAGTCTCCAGAGGGAACACAGCCCTGCAGATGCCTTGATTTTAGCCCTCGAAAAACAGGGTCC
GCTTTCTGTCTCCAGAATCGGAGGGGGTCAGTGTGCTCTCTCCTGCTGCCATGCTTCTGATAATTTTCTACAGCAGCAAC
AGGAAACCAACACTGGAACCCAGGTCAAGGACAAGTTAAGAAAAGACACAAGGATAGCCAGGCATGGTGGCAGGTGCATG
TAATCCTAGCGACTCGGGAGGCTGAGAGCAGGAGAATCGCTTGAACCCAGGAGACAGAGGTTGCAGTGAGCGTAGACCAC
ACCACTTCACTCCAGCCTGGGTGAAGGAGTGAGACTCTGTCTCCAAAATTAATTAATTAATTAAAGAAACCAAACAAAGA
GAAGGTTGGCTACACCGAGATCAGCAAGGGTGGGATGATGATGCCACCACCAGGCTCCATCCACATAGGGAGGGGTTGAT
ACTCCTCAAATCAGCACGAGGAGCCAGCCTATGGAAACTGGCACCATGGAGAAGGCACAGACATGGCAAGAGTGGCTCCC
AGTCCCCACCAGGAACAGGGTGTGTGGACACTGGTGCCTGCCTTACTGATCAGTTCATACCTCCTGCCAAGGATTCCAAT
TCGTCCAAAAGAGATTGAACCAGGCTGCTAAGAGCCGGGACGTGCAGCCTATCCTGCTTCCTCTTCCACTCCCACATAGA
CAGTAAGAAAGACATTAGTGTGAAATAGATACAACAGCCCAAGAGATGAGGCTGAGCCCAGTGGGAAGGGAATCACAGCT
ACTAGAGACAGAGGGACAGAGAAGAGGGAGGGAGACAGATGGAAGGACCTGCACCAGGAGTTATGGGCACAGAAAAGAAC
ATGAAGACACAGAGAGGAAGCAGAGAGACAGACACCAGCGAAGGGAAGTCTCACTCATTCCAGGTGCCATGGATGGGATG
ATAAAGAGAGACACCTTCTAAACTCACAACCTCTCTTCCTAGGAGTCCACAGAAAACCTTCCTTCCTGGCCCTCCCAGGT
CACCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCGGATGTCATGTTTGAGCACTTCCTTCTGCACAGAGA
GGGGAAGTTTAACAACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTTTCCAAGGCCAACTTCTCCATTGGTCCCA
TGATGCCTGTCCTTGCAGGAACCTACAGATGCTACGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGAC
CCTCTGGACATGGTGATCATAGGTGAGAGTGTCCAGACATTCTTCTCATTGTCATTGGGATGCAGAGTGAATGATCCAGG
ACTTGGAGACCCAGGTGGTTGTAAGGAAGATGAGCTTGGTATTCTTATGGAGAGAGACTGACTTGGTGAGGTCTGTGCCA
ACAGAGACAGAGAAACAAGAGACACAAGTACAGACCAGGTGTCATAACAGAGGACAAACACAGGGGCCATACCGGGAGTT
AGAAAAGACAGAAAGAGTTAAAGGAGACAGACAGACATGTCCCAGACAGAGGTGTCCTTCCATGCTGACTTTGCTCAGAG
ACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTGTTCTCTACCAGGAGAACCCAAGGACACCCATA
TTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCACCTACAGATGCCATGCTTATTCTGACACCTCTGACTT
CCATGCAATGGAGAATAATCGTCCCAAAATATCATGGCCCCAGAACACCAACCCCTGTATGCTGTGTGAACTTGTGGTCT
CCAGACTGGATTCTGAGGCTCACATTCCAAATAACCCCACATATCACATATGAGAGGATCACTGAGAAGCACAGAGAGAA
ATCAGGGACACCAAAAAGCAAAGACATAAACACACAGAGAAAGAGCCAGAGGAAGGAGATTGAGAGACTCACAGACACAT
AAAGAGAGAGAAGAGGGCAGAGAAGTGGAGAGAATGATGGAAGAGAGCAGAGAAAACCACTAAAATTAGAGTCCTGAGGG
CGAGGCACAAGGGCATAGAAAGATGGAGATGTGGGGATGAATTGCAGAGATTCCAAAGAGAACTAGAGAGACCGAGAGGC
AGAGCAAGACAGATGATAGATGGATAGATACAGATAGATGATGGATAGATATAGATAGATGATATATAGGTAGATGATAG
ATAATAGGTTATAGATACATAGATGATGATTGATTGATTCATTAATAGATGATACATAGAGATGATGATGATGAAGATAG
ATGGATAGATAATACATAGAGATAGAGAGGAAGACAAAGAGAGAAATAATAGAGAGAGAGAGATGATACATATATATAGA
TAATAGATGATTGACGGATAGACAATTGATAGATAAATAGATGATATATAGATATAGATGACAGGTAGAGAATTTGTAGA
TAGGCACCGAATAGATAAATAGATGGATTGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACGGGACACAAACTG
AGAAACTCAGAGTTAAAAAAAGTAACATCAAGTCAACCAATCCAAGGAGAGCCAGAGAGAATAAAACAATCCAAAAAAGG
AAAACATAACTAGAGGTAGGGAAGTGAGGTCAGAGACCTACAGAGACAGAGAAGGTGGAAGGAGGAAATAGACATGAAGA
GAGATAGGGTGGAGGGTGAGACAGAGAAAGAGAGCATTAGGCCATAGAGCAGGGGAGTGAGTTCTCAGGTCAGGTGTGAG
GGGAGCTGTGACAAGGAAGATCCCCCCTGAGGAAACTGCCCCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCTCTCA
GCCCAGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCA
TCTATCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGTGCGCAGCATCAACGGAACATTCCAGGCCGACTTTC
CTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGACGCTCCCTACGAGTGGTCAAACTCG
AGTGATCCACTGCTTGTTTCCGTCACAGGTGAGGAAACCCCATATCTGTCCCATGTCCTATGATCCTAGAGCCTTAGCTG
AGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGACAGATGCAGAGAGAAGACGCAGCATGCCTGTGAGGGAGGGATCAG
GGCGCAGGATGGCACACACAGCACCTCCAAACCCTCCTGCATGGCCTGCATGGAGGCCTCCGATTAGGGCTCCAGAAACC
CAGGCAGATGTAGAAAGCGGTCAGGAGAGACCCAGAGAAGGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGTTCCCTC
AGCCCCTCAACCTTACCCATTTCCCAGAAGCCCTTCCTGGCCTCTCACCCACACAGAGATGTCATCACCAGCAACCCCTA
CATCCTTTTCTTTTTGTTTGAAAAAATATTCATTGAGGTTAAATATACCTATATAGCTTACCACTTTTAACATTTTTTTT
TTTTTGAGGTGGAGTCTAGCTCTGTCTCCTATGCTGGAATGCAGTGGCACAATCTCAGCTCACTGTAACCTCCGCCTCCT
GGGTTCAAGCGATTCTCCTGCCTCAGCCACCTGAGTAGCTGGTACTACAGGCGCCCATCACCACGCCGGGCTACTTTTTG
TATATTTAGTAGAGAGGGGGTTTCACCATGTTGGTCGAGCTGCTCTGGAACTCCTGACCACGTGATCCACCCGCCTCAGG
CTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCGCGCCCGGCCACGTTTACCAATTTTAAGTGTAAGGTCTAGTGGTC
ATAAATACATACATATAAATTTTTTGTTTGTTTGTTTTATCCTCCACCCTTTTCTTCCTGGCCTCTGGTAGCCACCATTC
TACTCTCTATCTTCATGAGATCCACCTTTTAGCTCCTGTATATGGGTGAGAAATGAGAATATTTGTAATGACTTCCAGTT
CCATCCATGTGGCTGCAAATATCAGGATGTTATTCTTTCTATGGATGAGTAGTCTCCGCTGTGCGTATGTACTACATTCT
CTCTATCCATTCATCCACTGATGGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAAGAGTGCTGCACCAATCATAC
GAGTGCAGATATCACTTCGATACATTGATTTACTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGATACTATGAA
AGTTCTCTTTTTAGTTTTTCGTTTGTTGTTTTGTTTTTGTTTTTGAGACAGTTTCCCTCTGTGCCCAGGCTGGAGTACAA
GTGATGTGATCTTGGCTCATTGCAACCTCCGCCTCCTGGGTTCAAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCTGGG
ATTACAGGTGCACGCCACCATGCCGGGATACTTTTTGGTTTTTTTTAGTGTACATGGGGTTTCCCCAGGTTGGCTAGGCT
GCTCTCAAACTCATGACCTCAACTGAGGTGCCCGCCTCGGTCTCCCAAAGTGCCGGGATTACAGGCATGATCCACTTCAT
CCAACCTCTTTTTAGTTCTTTAAAGGACTTCCATACTTTTCTCCGTAATGGCTGTACTAATTTACACTCCTACCAACAGG
GTACCAGGGTTCTCCTTTCTCTACCACCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTTATT
TCATTTTATTTTGAGATGGAGTTTCGCTCTTGTCACCCAGGCTGGAGTGCAGTGGTGCGATCTCGGCTCACCGCAACCTC
CACCTCCCAGGTTCAAGCGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGAATTACAGGCACACACCACCACGCCCGACT
AATTTTTGTATTTTTAGTAGAGACAGCGTTTCTCCATGTGGGTCAGACTGGTCTCAAACTCCCGACCTTATGAGATTCGC
CCACCTCGGGCTCTCAGAGTTCTAGGATGACAGACGTGAGCCACCTCGCCCGGCCTAAAAGCCATTTTAATGGGGTGAGA
TGAAAACTCACTTTGATTTTAATTCGCGTTTCTCTGATGATGAGTGATACTGAGCACTTTTTCGTATGTGGGGAAATTTC
ATGTCTTTTGCTCCTTTTTCAATTAAATCATTTGTTTTATTGAGTTGTTTGAGCTTCTTATACTTCTAGTTATTAATCCC
GTCTCAGATGCATAGTTTGCACATATTTGCTCCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCGGTG
CAGAAGTTGCTTAGTTTGAGGTAATCCCAATGGTCTATTTTTGCTTCGATTACTTGTGTTTTGAAGGTTTAAAACAAAAT
GTCTTCCTTCAGACAAATGTACTGGAGCATTTCCCCAATATTTTCTTCTACGTGTTTCACAGGTTCAGGCCTTAGACTCA
CATCTTTAATCCACTTTCATTTGATTTTTGTGTATGGTGACAGGTAGAGGTGCAGTTTCATTCCTCTGCATGTAGATGTC
CAGGTTTCCCTGCACTGTTTATTGAAAAAACTGTCCTTTCCTGATTGTGAGTTCTTGGCACCTTTGTCAAAGTCCATTGG
ATGGGCTGGGCATGGTGGCTAACACCAGCAACTTCAGCACTTTGGGAGGCCAAGGCTGGTGGATCACCTGAGGACAGGAG
TACAAGATTACTCTGGCCGACGTGATGAAACATCGTCTCCACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCAC
CTGTAATACTACTACTCAGGAGTTTGAGGCAAGAGAATTGATTGAACCCAGGAGGCTGAGGTTGCAGTGAACCGAGATTG
CACCTCTGCACTCCAGCCTGGGTGACAGAGCAAGACTCCATCTCAAAAGAAAAAATAAAAAAAATTGGATGTAAATGCAT
GGATTATATCTGTGTTCTTCATTCTGCTCCGTTGTTCTATGTGCCTTTCTTCATGCCAACATCATGCTGTTTTGCTTACT
ACAGCTCTGTAACATATTTTGAGATCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTGAAGTCTCAAGACAGTGG
GCGTCACATACAAAAATTATGGAAGAAAGGATCCCTGGACTCCCAGGGCCCAATGTTAGATAACAGAGTGTTGGCCATGA
ACCAAACTCAAAGATTTCCACTGAGTAGAGGACAGACACCCTCATTTCCTCACCTCTCTCCTGTCTCATGTTCTAGGAAA
CCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTGAGTACAGGACCCTCTTATATCCGCTTTTGG
AACCCTGGGGAGGTGGAAACCTTGGATTCAGGCGTTGACTCAGCATCTCACAGCTCTGACATTGTACGCCTGTCTTCTAC
CATCTCCGAACTCCAGATACTCCAACAGCGAAAGGGATCTGGGCCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTCA
TTTTATGGAGCTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAACGCAATGTTTG
TTCTGCTTGCATTCCTAACTGGAGGATAAATTCCTGGGGGCTTGAGAGAGGGAAGGGAAGCGAACATCTGATGAGGGCGA
GGTGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAGCTCCTGTTGGTCATGAAACAACCCTGGCTGACTCAGCAGAGCAA
GAGCCTTGCCGTAACAGAGAACAGAGCTCATGCACGCACACTTTGACTCACTGACTTATTCAGCCACGGCCCCATGCTCA
GGTTGTGCAGTGTGGAAGCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTAT
TTAATTATCTTACAGTGCTCTAGCTCAAAGCATGAAGTGCATCTCACTGGGCTAAAATCAAGATGACAGCAAGCCTGCCT
TCCCTCTGAGGATTCCAGGCAAGAATCTGCTTCTCACTTGTCCCATCTTATAAAGGCTCCCAGTTCCTTGGCTGCTGGTC
CCTTTCCTCCTTCCTCAAAACCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACC
TCTTTCTCTGAATGCTGCTCTCCCTTCTTCCTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAAT
CCGTCATAATCTCCCGGAAATCATTCAGGATACCCTTGTTTTAAGTTCAGCTGATTAGCAACCATAATTCCATCTGCAAT
CTTCATTCCTCCTTTCCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGC
ATTCTCCTGCCTTCCACAAATGGTGAACAAGATGCATTTGGCCTCTGCTCTTGGGACACTGATATTGCAGATGGTTAAAT
GGGAGGACAGAAAATGAATGCACAAGTGGACCAATAAATGAATGATCCATTGGGAAGCATCTGTGCATGAAATCTATTTG
TTTGTTTGTTCGTTTGTTTATTGAGACAGAGTCTCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCAC
TGCAACCTGCGTCTCCTGGATCCAAGTGATTCTCCTGCCTCACCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCA
TGCCCGGCTAATTCTTTTTGTATATTTTTTGTAGAGAGGATGTTTCACCATGTTGGCCAAGCTTGTCTGAAACTCCCAAC
CTCAAGTGATCCGACCATCTCAGCAACCCAAAGTACTGGGATTACAGGCGTGAGCCACTTTGCCCAGCCAGAATTCAAAA
TAAATAATAGATAATGCTGAGTGTATAATTTTGGGTGACAGAGAAGGTCTCACTAATCAGATATTTGTGACATTAATGAA
AAACACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTTTCCACACACAGCTGTCAGCTGTGAAGGCACAAAGGTGAAA
ACAATCTGATGTTGAAGGAAGAGGCTCTGCCTGAAATGCTGGGAATGAGGTGGGGAGAATGACAAGATGACTGTAGAGAG
ATGGAGAGCACTCTGGGTACACAGGAAACTAAGGAGGAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACC
TCGGGGTAACCAGGAATCCCTACATGATTAATAGTGACTGACAAGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCT
AGGAGACTGTGGAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGATG
GATATAAGATATGCTTGTGAGGTAGAATCATTGGCTGGAAAGGCTTGCTGGGTTTGATTTTCCTACTTGTTTAATCCTCG
CTTAATTAATTTCTTTCTGAGATTTATTCATCCTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGG
TGGTGGAAATGAAGGGACCTATTATAGCATAATATACAAGTCTGTGAACGGTGGCTCATGCTTGTAACCCAGCCCTGCAG
GAGGCCAAGGCGGGTGGATTCCATGAAGTCAGGAGTTCCAGACCAGCCTGGCCAACATGGTGAAACCCTATCTGTACTAA
AAATACAAAAATTAGCCGAGCATGGTGGTGCATCCCTGTAATCCCAGCTCCTACTCTGGAGGATGAAGCAGGAGAATGAC
TTCAACCCAGGAGGTGGAGGTTGCAGTGAGTGGAGATTGCATCACTGCACTCCAGCCTGGGTGACACAAGGAGACTCCGT
CTCAAAAAATAAAAATAAGAAATGCATAAATATAATAAAACACACACGAATGACAAAGGCACCTGAATTCCAATCATCAT
TTTTCTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATCAGCCTAAAACCTCTTCCCTATTTG
GCTTTCTGTGAGCATGAGATCACATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCACGGATCCTGGAATAGAGAAAGT
GCTCTGGTCATCGCAAAAAAAAACTTGCCCACTCACCCAAATCGCCCACCTCACCCCTACTTCCAATCACCTGTGGAGAT
TCAGATAGACCATGGGGAGGAAACATTAATATTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATCAGCGACAGCACT
AGCTCCTGTTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTATTGAAGCAATAGATGGTGGAGGGGGTGGTCCTTC
CCCCAGCCTCTCGGGTAGAACAGCAGCCTAACATGTGTCTCCCGAGATCACAAAGAGCAGCACATTTCACACGGGCTTCA
ACACTATTTTCTGGCTGTTTGACATAAGAGAATCTTGCTTCGCTATTTTTAATCGTGATTTCACCTTTGTTTCCTTTCCT
TGGTGAATGCAATTTGTTTGACTCAAGAATGCTGTGGATGTAGAAATCCTAAAGCACATTCGCTGTGTATCAATCCCAGT
GCAGTCTTCCCAGAGAAGACTCTAAACAAATCCTGGACTGCACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTC
CAGGGAGACAGAACACACAGAGGATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGC
CTGCATTTCAATGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTGCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAA
CTGGGGGAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGA
CGTCCTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGAGACATTCCTCCTGATCTCAGGATGTTGCTATCTTA
GTCCATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGGGTAACTTCTAAAGAAAAGAGATTGGTTTGCCTCACAGTTCTG
CAGGCTGTACTGGAAGCATGGCACCAGAATCTATTTCTCTTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGG
AGGGTCTGTCTGTGCAGAGACCGCAGAGATCACACGGCAAGAGAGAGAGTAAGGGGGAGAGGGAGCGATGGAGCTTCCAA
GCTCTTTTTAACAACCAGCTCTCCAGGAACTAACAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGATCT
GTTCATGATGGATCCACCTCCATGACCCAAACACCTCTGAAGAGGCCCAACCTCCCACAATGGGGGTGAAATTTCAATGT
GAGGTTTGAAAGGGTCAAACATCTCAACTAAAGTAGTTGTATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAATT
GAGAAAGCAGGGGAAAGCTAGGTCTCCCGCCATTTGGGTGCTTGTCCTAAAGAGACGTTGTATGTGGTTACCTGCCAATC
AAGAAATGCGAGACAATTCATAAAGAGGAACTGCTATGATTAGCTTCTTATTGGTGTCTCCTCTTCTTCCAGGTAACCCC
AGACACCTACATGTTCTGATTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTG
GTGCTCCGACAAAAAAAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCAC
GCGGATGTGTGTTCCTCACCAGCAGGATGGTCCCTGGCCCAAGACAGGAGCCACAGAGGCAGGACTTTCTAGAGAGAGCA
CCAGATTCCCTTCCCCTGCCTTCAGCTCACAGACCATTGCCTGATTCTGAACTGTATCCTCACGTCCCCTGCAGCCACTC
ACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGAGATAGAATCAATGGGATGGGAACTCAGAGCTATTCATGGGA
TGGGTCCTTGAACTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGGCACCTATGGCCTCCCC
CTGTTTGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTCTTTTGTTGACTTCCGTCTTCTACAGA
TGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGTAGGTGCTCCTCGGCCCAGCCTCGTGG
CTAGTCTTATTCCCAAAGAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGATTCTGATG
AACAAGACCATCAGGAGGTGTCATACGCATAATTGGATCACTGTGTTTTCACACAGAGAAAAATCACTCGCCCTTCTGAG
AGGCCCAAGACACCCCCAACAGATACCAGCATGTACATAGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTTCTG
TCCACGAGCACCACAGTCAGGCCTTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCTCC
CATGTACCAGCAGCTGGAATCTGAAGGCATCAGTCTTCATCTTAGGGCATCGCTCTTCCTCACACCACGAATCTGAACAT
GCCTCTCTCTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAGAAAACACACTCCTTTGCTTAGCCCACAATT
CTCCATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTACCTGAGGCTGCAATCACACTG
AGGAACTCACAATTCCAAACATACAAGAGGCTGCCTCTTAACACAGCACTTAGACACGTGCTGTTCCACCTCCCTTCAGA
CTATCTTTCAGCCTTCTGCCAGCAGTAAAACTTATAAATTTTTTAAATAATTTCAATGTAGTTTTCCCGCCTTCAAATAA
ACATGTCTGCCCTCAT

IPD-KIR