Allele Report for 2DS4*0010104


2DS4*0010104
Previous Designations & Local Names: ABC08_A1hap
IPD Acc No: KIR00452
Assigned: 28-AUG-2009 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182360  
Cells Sequence Derived From: ABC08  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (304 aa)
MSLMVIIMACVGFFLLQGAWPQEGVHRKPSFLALPGHLVKSEETVILQCWSDVMFEHFLLHREGKFNNTLHLIGEHHDGV
SKANFSIGPMMPVLAGTYRCYGSVPHSPYQLSAPSDPLDMVIIGLYEKPSLSAQPGPTVQAGENVTLSCSSRSSYDMYHL
SREGEAHERRLPAVRSINGTFQADFPLGPATHGGTYRCFGSFRDAPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA
Nucleotide Sequence Data (915 bps)
ATGTCGCTCATGGTCATCATCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACAGGAGGGAGTCCACAG
AAAACCTTCCTTCCTGGCCCTCCCAGGTCACCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCGGATGTCA
TGTTTGAGCACTTCCTTCTGCACAGAGAGGGGAAGTTTAACAACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTT
TCCAAGGCCAACTTCTCCATTGGTCCCATGATGCCTGTCCTTGCAGGAACCTACAGATGCTACGGTTCTGTTCCTCACTC
CCCCTATCAGTTGTCAGCTCCCAGTGACCCTCTGGACATGGTGATCATAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTA
TCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGTGCGCAGCATCAACGGAACATTCCAGGCCGACTTTCCTCT
GGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGACGCTCCCTACGAGTGGTCAAACTCGAGTG
ATCCACTGCTTGTTTCCGTCACAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTAAC
CCCAGACACCTACATGTTCTGATTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCG
CTGGTGCTCCGACAAAAAAAATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGATTCTG
ATGAACAAGACCATCAGGAGGTGTCATACGCATAA
Genomic Sequence Data (16092 bps)
GTTTGGGAGGTTGGATCTAAGACATGTTTTGAGTTGGTCATAGTGAAGGACGCGAGGTGTCAATTCTAGTGAGAGCAATT
TCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAAAGCCTGCGTACGTCACCCT
CCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGTGCTGCTGAGCTGAGCTGGGGCG
CGGCCGCCTGTCTGCACCGGCAGCACCATGTCGCTCATGGTCATCATCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAAT
AGAGGGAGGGAGCGTGGGGATGGAGATCTGGGCCCAGAGGTGGAGATATGGGCCTGGAGGTGGAGTTATGGGCCTGGAGT
GGAGATCTGGGCCTAGAGATGGAGTGATGAGCCTAGAAGTGGAGATCTGCGCCTGGAGTGGAGATCTGGGCCTGGAGTGA
AGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGGGATAGGAACCTGGAGTGGAGAGAGGAACCTGGAGGAGAGAT
AGGAACCTGGAGGGGAGGTAGGAGCCTAGGGTGGAGATATGGGACTGGAGTGGAGATATGGGACTGGAGTGGAGATATGG
GCCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTATGGGCCTGGAGGTGGAGATACGGGCCTGGAGTGGAGATATGAGCC
TGGAGTGGAGATATGGTCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGTCTGCAGTGGAGTTATGGGCCTGGA
GTGAAGTTATGGGCCTGGAGGTGGAGATATGGGACTGGAGTGGAGATATGGGACTAGAGTGGAGATAGGGGCCTGGAGGT
GGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAG
ATATGGGTCTGCAGTGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTA
TGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGATATGGGACTAGAGTGGAGATAGGGGCCTGGAGGTGGAGATCTG
GGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGAGCCTGGAGTGGAGATATGGCCC
TGGAGTGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGTTATGGGCCTGGAGTGAAGTTATGGGCCTGG
AGGTGGAGATATGGGCCTGGAGTGGAGATATGGGACTAGAGTGGAGATACGGGCCTGGAGGTGGAGATCTGGGCCTGGAG
TGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGAGCCTGGAGTGGAGATATGGCCCTGGAGTGGA
GATATGGGCCTGGAGTGGAGATATGAGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATA
TGGGCCTGGAGTGGACATATGGGTCTGGAGTGGAGATACGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGATATGG
GCCTGGAGGTGGTGATATGGGCCTGGAGTGTAGACATGGGCCGAGTGGAGATATGGGTCTGGAGTGGAGATATGGGCCTG
GAGTGGAGATATGGGACTGGAGTGGAGATATAGGCATGGGGTGGAGACATGGGCCGGGAGTGGAGATATGGGACTGGAGT
GGAGATACGGGCGTGGGGTGGAGATATGTGCCTGGAGGTGGAGATATGGGCGTGGGTTGGAGATATGGGCCTGGAGTGGA
GATATGGGCGTGGGGTGGAGATATGGGTCTGGAGTGGAGACATGGGCATGGGGTGGAGATATGGGCCTGGTGTGTAGATA
TGGGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATCTGGGCCTACGGTGGAGATATGGG
CCTAGGATGGGGATATGGGCCTGGAATGGAGATATGGGCCTGGGTGTGGAGATATGGGACTGGAGTGGAGATATGGGCCT
GATGTGGAGATATGGGCTTGGAGTGGAGATATGATCCTGGAGTGTAGTTATGGGCCTGGAGGTGGAGATCTGGGCCTGGG
GTGGAGATATGGGCCTGGAGTGGAGATATGGGACTGGAGAGGAGATATGGGACTGGAGTGGAGATATGGGCCTGGAGTGG
AGATATGGGCCTGGATTGGAGATATGGGCCGAGGGTGGAGATCTGAGCCTGGATTGGAGATGTGGGCCCGGATTGGCTAT
ATGGGTCTAGGGTGGAAATATCGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCTTGGGGTCGGGATATGG
GCCTGGAGGCTGGGTCTCTGTACAGCCGAGAGCACTGTTCTTGGGTGCAGGTAGGCACTGATGGTGAGTTTACCTTCGGC
CCAGGAAGGGGCTGGCTATCAAGACTCACAGCCCAGTGGGGGCAGCAAGGAAGGCCTTGTTTGCCTGCAAATGGATCTTC
CATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACAGGAGGGTAAGTCCTTCTCCAAACCTTAG
GGTGTCATCTCCCCACATAAGAGGATTTTCCTGAAACGGGAGGGAAGTCCTGTCAGGGAGTCTCTCATAAACTAGGAAGA
GGGGACCCTGGGGTGCTCGGCCCACAGTTCCGACCTTGCCTCCCTGGCCTCTCAACCCCTTGGCAGAGTCAAGTTGTGTG
GGGACCAGGGTTGGACTAGGGTGTTCAAAGCTGGGTTGTGTGGTGGGGAAGTGGTAGGAACAGCAGATCCTCTGAGGACA
AAGGTGTTACTCACACACTTCAGCGTTTCCATGACGGTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCAGAAGAGGTG
GGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGATGGGGGCTAAGTTTTTTATTTTCATTCAGGCAACTGCTGA
TATTCCATTCTCAAAGGACATGCCCTCCACTTCATGTCTACCCTGTGTTGTTTTATGTCAGTAATCTTACAGTATTAAAA
TCTAGTAGGAGTCTCTTACTCAGCACTTGCTCAAAGTTCTCAGCTGACACTTTTGTTGTACGGAGACACCTTGTCTTTGT
GGGATGGGTCCTTCCTTTAGCCCTAGGCACCAAGGTGTGATAGCAGCCATAGAAATGTGGAAAGTGGGGAGAATCTTCTG
AGCACAGGGAGGGAGGCACAGCTCCACATCCTCCTCTCTAAGGCGGCGCCTCCTTCACCCCAAGGTGGTCAGGACAAGCC
CTTGCTTTCTACCTGGCCCAGCCTTGTGGTGCCTCCAGAACATGTGACTCTTCAGTGTCACTCTAATCTTGGGTTTAACA
ACTTCAGTCTGTACAAGGATGATGGGGTGCCTGTCCCTGAGCTGTACAACAGAATATTCTGGAAAAGCCTTTTCATGGGC
CCTGTGACCCCGTCACATGCAGGGACCTATAGATGCCGGGGTTCACACACACACTCCCCCAGTGGGTGGTCGGCACCCAG
CAACCCCCTGGTGATCATGGTCACAGGTCAGAGGGCTCCTGTCTGGGATTCTCCTTGTCCCACCTCCTGAATCCCAGAGC
TTCTGGTAGGCATGTCCTTGAGGGTCCCATCATGCAGGCCCTAACTGTATTTGGGGTAAAGGGGGATTGAATACAGGGAA
ATGGGTGCTGTGGTGGGAAGAATAAGTGTCCCCAGTGATGACTGCATTCTAATCCCTGGAGTCTGTGACTATTTATGTTA
TAGGGGAAGGGACTGAAGGGGAAGATGGAGCTCAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGACAGCCTGGACTGT
CCCGGTGGGCTCAATATAATCACAAGTGTCCACATGAAAGGAGGAGGAAGAGGAGAGTGGGGATTAGAGCAGCGTAGTGG
GAGACTCCATTAGCTTTGAAGGTGGATGAAGGCCATAAGCCATGAATGCAGGTGGCCTATAGAGGCTGGGAAAGTCAAGT
AACTGATTCTCCTGAGTCTCCAGAGGGAACACAGCCCTGCAGATGCCTTGATTTTAGCCCTCGAAAAACAGGGTCCGCTT
TCTGTCTCCAGAATCGGAGGGGGTCAGTGTGCTCTCTCCTGCTGCCATGCTTCTGATAATTTTCTACAGCAGCAACAGGA
AACCAACACTGGAACCCAGGTCAAGGACAAGTTAAGAAAAGACACAAGGATAGCCAGGCATGGTGGCAGGTGCATGTAAT
CCTAGCGACTCGGGAGGCTGAGAGCAGGAGAATCGCTTGAACCCAGGAGACAGAGGTTGCAGTGAGCGTAGACCACACCA
CTTCACTCCAGCCTGGGTGAAGGAGTGAGACTCTGTCTCCAAAATTAATTAATTAATTAAAGAAACCAAACAAAGAGAAG
GTTGGCTACACCGAGATCAGCAAGGGTGGGATGATGATGCCACCACCAGGCTCCATCCACATAGGGAGGGGTTGATACTC
CTCAAATCAGCACGAGGAGCCAGCCTATGGAAACTGGCACCATGGAGAAGGCACAGACATGGCAAGAGTGGCTCCCAGTC
CCCACCAGGAACAGGGTGTGTGGACACTGGTGCCTGCCTTACTGATCAGTTCATACCTCCTGCCAAGGATTCCAATTCGT
CCAAAAGAGATTGAACCAGGCTGCTAAGAGCCGGGACGTGCAGCCTATCCTGCTTCCTCTTCCACTCCCACATAGACAGT
AAGAAAGACATTAGTGTGAAATAGATACAACAGCCCAAGAGATGAGGCTGAGCCCAGTGGGAAGGGAATCACAGCTACTA
GAGACAGAGGGACAGAGAAGAGGGAGGGAGACAGATGGAAGGACCTGCACCAGGAGTTATGGGCACAGAAAAGAACATGA
AGACACAGAGAGGAAGCAGAGAGACAGACACCAGCGAAGGGAAGTCTCACTCATTCCAGGTGCCATGGATGGGATGATAA
AGAGAGACACCTTCTAAACTCACAACCTCTCTTCCTAGGAGTCCACAGAAAACCTTCCTTCCTGGCCCTCCCAGGTCACC
TGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCGGATGTCATGTTTGAGCACTTCCTTCTGCACAGAGAGGGG
AAGTTTAACAACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTTTCCAAGGCCAACTTCTCCATTGGTCCCATGAT
GCCTGTCCTTGCAGGAACCTACAGATGCTACGGTTCTGTTCCTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCTC
TGGACATGGTGATCATAGGTGAGAGTGTCCAGACATTCTTCTCATTGTCATTGGGATGCAGAGTGAATGATCCAGGACTT
GGAGACCCAGGTGGTTGTAAGGAAGATGAGCTTGGTATTCTTATGGAGAGAGACTGACTTGGTGAGGTCTGTGCCAACAG
AGACAGAGAAACAAGAGACACAAGTACAGACCAGGTGTCATAACAGAGGACAAACACAGGGGCCATACCGGGAGTTAGAA
AAGACAGAAAGAGTTAAAGGAGACAGACAGACATGTCCCAGACAGAGGTGTCCTTCCATGCTGACTTTGCTCAGAGACCT
GGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTGTTCTCTACCAGGAGAACCCAAGGACACCCATATTTC
TGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCACCTACAGATGCCATGCTTATTCTGACACCTCTGACTTCCAT
GCAATGGAGAATAATCGTCCCAAAATATCATGGCCCCAGAACACCAACCCCTGTATGCTGTGTGAACTTGTGGTCTCCAG
ACTGGATTCTGAGGCTCACATTCCAAATAACCCCACATATCACATATGAGAGGATCACTGAGAAGCACAGAGAGAAATCA
GGGACACCAAAAAGCAAAGACATAAACACACAGAGAAAGAGCCAGAGGAAGGAGATTGAGAGACTCACAGACACATAAAG
AGAGAGAAGAGGGCAGAGAAGTGGAGAGAATGATGGAAGAGAGCAGAGAAAACCACTAAAATTAGAGTCCTGAGGGCGAG
GCACAAGGGCATAGAAAGATGGAGATGTGGGGATGAATTGCAGAGATTCCAAAGAGAACTAGAGAGACCGAGAGGCAGAG
CAAGACAGATGATAGATGGATAGATACAGATAGATGATGGATAGATATAGATAGATGATATATAGGTAGATGATAGATAA
TAGGTTATAGATACATAGATGATGATTGATTGATTCATTAATAGATGATACATAGAGATGATGATGATGAAGATAGATGG
ATAGATAATACATAGAGATAGAGAGGAAGACAAAGAGAGAAATAATAGAGAGAGAGAGATGATACATATATATAGATAAT
AGATGATTGACGGATAGACAATTGATAGATAAATAGATGATATATAGATATAGATGACAGGTAGAGAATTTGTAGATAGG
CACCGAATAGATAAATAGATGGATTGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACGGGACACAAACTGAGAA
ACTCAGAGTTAAAAAAAGTAACATCAAGTCAACCAATCCAAGGAGAGCCAGAGAGAATAAAACAATCCAAAAAAGGAAAA
CATAACTAGAGGTAGGGAAGTGAGGTCAGAGACCTACAGAGACAGAGAAGGTGGAAGGAGGAAATAGACATGAAGAGAGA
TAGGGTGGAGGGTGAGACAGAGAAAGAGAGCATTAGGCCATAGAGCAGGGGAGTGAGTTCTCAGGTCAGGTGTGAGGGGA
GCTGTGACAAGGAAGATCCCCCCTGAGGAAACTGCCCCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTCAGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTA
TCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGTGCGCAGCATCAACGGAACATTCCAGGCCGACTTTCCTCT
GGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGACGCTCCCTACGAGTGGTCAAACTCGAGTG
ATCCACTGCTTGTTTCCGTCACAGGTGAGGAAACCCCATATCTGTCCCATGTCCTATGATCCTAGAGCCTTAGCTGAGGA
GCTTCCTGCTGATGATGGAGAGAAGCATGGACAGATGCAGAGAGAAGACGCAGCATGCCTGTGAGGGAGGGATCAGGGCG
CAGGATGGCACACACAGCACCTCCAAACCCTCCTGCATGGCCTGCATGGAGGCCTCCGATTAGGGCTCCAGAAACCCAGG
CAGATGTAGAAAGCGGTCAGGAGAGACCCAGAGAAGGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGTTCCCTCAGCC
CCTCAACCTTACCCATTTCCCAGAAGCCCTTCCTGGCCTCTCACCCACACAGAGATGTCATCACCAGCAACCCCTACATC
CTTTTCTTTTTGTTTGAAAAAATATTCATTGAGGTTAAATATACCTATATAGCTTACCACTTTTAACATTTTTTTTTTTT
TGAGGTGGAGTCTAGCTCTGTCTCCTATGCTGGAATGCAGTGGCACAATCTCAGCTCACTGTAACCTCCGCCTCCTGGGT
TCAAGCGATTCTCCTGCCTCAGCCACCTGAGTAGCTGGTACTACAGGCGCCCATCACCACGCCGGGCTACTTTTTGTATA
TTTAGTAGAGAGGGGGTTTCACCATGTTGGTCGAGCTGCTCTGGAACTCCTGACCACGTGATCCACCCGCCTCAGGCTCC
CAAAGTGCTGGGATTACAGGCATGAGCCACCGCGCCCGGCCACGTTTACCAATTTTAAGTGTAAGGTCTAGTGGTCATAA
ATACATACATATAAATTTTTTGTTTGTTTGTTTTATCCTCCACCCTTTTCTTCCTGGCCTCTGGTAGCCACCATTCTACT
CTCTATCTTCATGAGATCCACCTTTTAGCTCCTGTATATGGGTGAGAAATGAGAATATTTGTAATGACTTCCAGTTCCAT
CCATGTGGCTGCAAATATCAGGATGTTATTCTTTCTATGGATGAGTAGTCTCCGCTGTGCGTATGTACTACATTCTCTCT
ATCCATTCATCCACTGATGGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAAGAGTGCTGCACCAATCATACGAGT
GCAGATATCACTTCGATACATTGATTTACTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGATACTATGAAAGTT
CTCTTTTTAGTTTTTCGTTTGTTGTTTTGTTTTTGTTTTTGAGACAGTTTCCCTCTGTGCCCAGGCTGGAGTACAAGTGA
TGTGATCTTGGCTCATTGCAACCTCCGCCTCCTGGGTTCAAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCTGGGATTA
CAGGTGCACGCCACCATGCCGGGATACTTTTTGGTTTTTTTTAGTGTACATGGGGTTTCCCCAGGTTGGCTAGGCTGCTC
TCAAACTCATGACCTCAACTGAGGTGCCCGCCTCGGTCTCCCAAAGTGCCGGGATTACAGGCATGATCCACTTCATCCAA
CCTCTTTTTAGTTCTTTAAAGGACTTCCATACTTTTCTCCGTAATGGCTGTACTAATTTACACTCCTACCAACAGGGTAC
CAGGGTTCTCCTTTCTCTACCACCTTGCCAGCATTTGTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTTATTTCAT
TTTATTTTGAGATGGAGTTTCGCTCTTGTCACCCAGGCTGGAGTGCAGTGGTGCGATCTCGGCTCACCGCAACCTCCACC
TCCCAGGTTCAAGCGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGAATTACAGGCACACACCACCACGCCCGACTAATT
TTTGTATTTTTAGTAGAGACAGCGTTTCTCCATGTGGGTCAGACTGGTCTCAAACTCCCGACCTTATGAGATTCGCCCAC
CTCGGGCTCTCAGAGTTCTAGGATGACAGACGTGAGCCACCTCGCCCGGCCTAAAAGCCATTTTAATGGGGTGAGATGAA
AACTCACTTTGATTTTAATTCGCGTTTCTCTGATGATGAGTGATACTGAGCACTTTTTCGTATGTGGGGAAATTTCATGT
CTTTTGCTCCTTTTTCAATTAAATCATTTGTTTTATTGAGTTGTTTGAGCTTCTTATACTTCTAGTTATTAATCCCGTCT
CAGATGCATAGTTTGCACATATTTGCTCCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCGGTGCAGA
AGTTGCTTAGTTTGAGGTAATCCCAATGGTCTATTTTTGCTTCGATTACTTGTGTTTTGAAGGTTTAAAACAAAATGTCT
TCCTTCAGACAAATGTACTGGAGCATTTCCCCAATATTTTCTTCTACGTGTTTCACAGGTTCAGGCCTTAGACTCACATC
TTTAATCCACTTTCATTTGATTTTTGTGTATGGTGACAGGTAGAGGTGCAGTTTCATTCCTCTGCATGTAGATGTCCAGG
TTTCCCTGCACTGTTTATTGAAAAAACTGTCCTTTCCTGATTGTGAGTTCTTGGCACCTTTGTCAAAGTCCATTGGATGG
GCTGGGCATGGTGGCTAACACCAGCAACTTCAGCACTTTGGGAGGCCAAGGCTGGTGGATCACCTGAGGACAGGAGTACA
AGATTACTCTGGCCGACGTGATGAAACATCGTCTCCACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCACCTGT
AATACTACTACTCAGGAGTTTGAGGCAAGAGAATTGAATGAACCCAGGAGGCTGAGGTTGCAGTGAACCGAGATTGCACC
TCTGCACTCCAGCCTGGGTGACAGAGCGAGACTCCATCTCAAAAGAAAAAATAAAAAAAATTGGATGTAAATGCATGGAT
TATATCTGTGTTCTTCATTCTGCTCCGTTGTTCTATGTGCCTTTCTTCATGCCAACATCATGCTGTTTTGCTTACTACAG
CTCTGTAACATATTTTGAGATCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTGAAGTCTCAAGACAGTGGGCGT
CACATACAAAAATTATGGAAGAAAGGATCCCTGGACTCCCAGGGCCCAATGTTAGATAACAGAGTGTTGGCCATGAACCA
AACTCAAAGATTTCCACTGAGTAGAGGACAGACACCCTCATTTCCTCACCTCTCTCCTGTCTCATGTTCTAGGAAACCCT
TCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTGAGTACAGGACCCTCTTATATCCGCTTTTGGAACC
CTGGGGAGGTGGAAACCTTGGATTCAGGCGTTGACTCAGCATCTCACAGCTCTGACATTGTACGCCTGTCTTCTACCATC
TCCGAACTCCAGATACTCCAACAGCGAAAGGGATCTGGGCCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTCATTTT
ATGGAGCTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAACGCAATGTTTGTTCT
GCTTGCATTCCTAACTGGAGGATAAATTCCTGGGGGCTTGAGAGAGGGAAGGGAAGCGAACATCTGATGAGGGCGAGGTG
TTTTAGAGAAGTTCCACTTGCCAAGGAATGAGCTCCTGTTGGTCATGAAACAACCCTGGCTGACTCAGCAGAGCAAGAGC
CTTGCCGTAACAGAGAACAGAGCTCATGCACGCACACTTTGACTCACTGACTTATTCAGCCACGGCCCCATGCTCAGGTT
GTGCAGTGTGGAAGCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTATTTAA
TTATCTTACAGTGCTCTAGCTCAAAGCATGAAGTGCATCTCACTGGGCTAAAATCAAGATGACAGCAAGCCTGCCTTCCC
TCTGAGGATTCCAGGCAAGAATCTGCTTCTCACTTGTCCCATCTTATAAAGGCTCCCAGTTCCTTGGCTGCTGGTCCCTT
TCCTCCTTCCTCAAAACCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACCTCTT
TCTCTGAATGCTGCTCTCCCTTCTTCCTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCGT
CATAATCTCCCGGAAATCATTCAGGATACCCTTGTTTTAAGTTCAGCTGATTAGCAACCATAATTCCATCTGCAATCTTC
ATTCCTCCTTTCCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGCATTC
TCCTGCCTTCCACAAATGGTGAACAAGATGCATTTGGCCTCTGCTCTTGGGACACTGATATTGCAGATGGTTAAATGGGA
GGACAGAAAATGAATGCACAAGTGGACCAATAAATGAATGATCCATTGGGAAGCATCTGTGCATGAAATCTATTTGTTTG
TTTGTTCGTTTGTTTATTGAGACAGAGTCTCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCACTGCA
ACCTGCGTCTCCTGGATCCAAGTGATTCTCCTGCCTCACCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCATGCC
CGGCTAATTCTTTTTGTATATTTTTTGTAGAGAGGATGTTTCACCATGTTGGCCAAGCTTGTCTGAAACTCCCAACCTCA
AGTGATCCGACCATCTCAGCAACCCAAAGTACTGGGATTACAGGCGTGAGCCACTTTGCCCAGCCAGAATTCAAAATAAA
TAATAGATAATGCTGAGTGTATAATTTTGGGTGACAGAGAAGGTCTCACTAATCAGATATTTGTGACATTAATGAAAAAC
ACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTTTCCACACACAGCTGTCAGCTGTGAAGGCACAAAGGTGAAAACAA
TCTGATGTTGAAGGAAGAGGCTCTGCCTGAAATGCTGGGAATGAGGTGGGGAGAATGACAAGATGACTGTAGAGAGATGG
AGAGCACTCTGGGTACACAGGAAACTAAGGAGGAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACCTCGG
GGTAACCAGGAATCCCTACATGATTAATAGTGACTGACAAGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCTAGGA
GACTGTGGAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGATGGATA
TAAGATATGCTTGTGAGGTAGAATCATTGGCTGGAAAGGCTTGCTGGGTTTGATTTTCCTACTTGTTTAATCCTCGCTTA
ATTAATTTCTTTCTGAGATTTATTCATCCTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGGTGGT
GGAAATGAAGGGACCTATTATAGCATAATATACAAGTCTGTGAACGGTGGCTCATGCTTGTAACCCAGCCCTGCAGGAGG
CCAAGGCGGGTGGATTCCATGAAGTCAGGAGTTCCAGACCAGCCTGGCCAACATGGTGAAACCCTATCTGTACTAAAAAT
ACAAAAATTAGCCGAGCATGGTGGTGCATCCCTGTAATCCCAGCTCCTACTCTGGAGGATGAAGCAGGAGAATGACTTCA
ACCCAGGAGGTGGAGGTTGCAGTGAGTGGAGATTGCATCACTGCACTCCAGCCTGGGTGACACAAGGAGACTCCGTCTCA
AAAAATAAAAATAAGAAATGCATAAATATAATAAAACACACACGAATGACAAAGGCACCTGAATTCCAATCATCATTTTT
CTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATCAGCCTAAAACCTCTTCCCTATTTGGCTT
TCTGTGAGCATGAGATCACATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCACGGATCCTGGAATAGAGAAAGTGCTC
TGGTCATCGCAAAAAAAAACTTGCCCACTCACCCAAATCGCCCACCTCACCCCTACTTCCAATCACCTGTGGAGATTCAG
ATAGACCATGGGGAGGAAACATTAATATTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATCAGCGACAGCACTAGCT
CCTGTTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTATTGAAGCAATAGATGGTGGAGGGGGTGGTCCTTCCCCC
AGCCTCTCGGGTAGAACAGCAGCCTAACATGTGTCTCCCGAGATCACAAAGAGCAGCACATTTCACACGGGCTTCAACAC
TATTTTCTGGCTGTTTGACATAAGAGAATCTTGCTTCGCTATTTTTAATCGTGATTTCACCTTTGTTTCCTTTCCTTGGT
GAATGCAATTTGTTTGACTCAAGAATGCTGTGGATGTAGAAATCCTAAAGCACATTCGCTGTGTATCAATCCCAGTGCAG
TCTTCCCAGAGAAGACTCTAAACAAATCCTGGACTGCACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTCCAGG
GAGACAGAACACACAGAGGATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTGC
ATTTCAATGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTGCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAACTGG
GGGAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTC
CTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGAGACATTCCTCCTGATCTCAGGATGTTGCTATCTTAGTCC
ATTTTTGTTGCTCTAAAGGAACACTTGAGCCTGGGTAACTTCTAAAGAAAAGAGATTGGTTTGCCTCACAGTTCTGCAGG
CTGTACTGGAAGCATGGCACCAGAATCTATTTCTCTTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGG
TCTGTCTGTGCAGAGACCGCAGAGATCACACGGCAAGAGAGAGAGTAAGGGGGAGAGGGAGCGATGGAGCTTCCAAGCTC
TTTTTAACAACCAGCTCTCCAGGAACTAACAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGATCTGTTC
ATGATGGATCCACCTCCATGACCCAAACACCTCTGAAGAGGCCCAACCTCCCACAATGGGGGTGAAATTTCAATGTGAGG
TTTGAAAGGGTCAAACATCTCAACTAAAGTAGTTGTATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAATTGAGA
AAGCAGGGGAAAGCTAGGTCTCCCGCCATTTGGGTGCTTGTCCTAAAGAGACGTTGTATGTGGTTACCTGCCAATCAAGA
AATGCGAGACAATTCATAAAGAGGAACTGCTATGATTAGCTTCTTATTGGTGTCTCCTCTTCTTCCAGGTAACCCCAGAC
ACCTACATGTTCTGATTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGC
TCCGACAAAAAAAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCACGCGG
ATGTGTGTTCCTCACCAGCAGGATGGTCCCTGGCCCAAGACAGGAGCCACAGAGGCAGGACTTTCTAGAGAGAGCACCAG
ATTCCCTTCCCCTGCCTTCAGCTCACAGACCATTGCCTGATTCTGAACTGTATCCTCACGTCCCCTGCAGCCACTCACAT
CCAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGAGATAGAATCAATGGGATGGGAACTCAGAGCTATTCATGGGATGGG
TCCTTGAACTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGGCACCTATGGCCTCCCCCTGT
TTGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTCTTTTGTTGACTTCCGTCTTCTACAGATGCT
GCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGTAGGTGCTCCTCGGCCCAGCCTCGTGGCTAG
TCTTATTCCCAAAGAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGATTCTGATGAACA
AGACCATCAGGAGGTGTCATACGCATAATTGGATCACTGTGTTTTCACACAGAGAAAAATCACTCGCCCTTCTGAGAGGC
CCAAGACACCCCCAACAGATACCAGCATGTACATAGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTTCTGTCCA
CGAGCACCACAGTCAGGCCTTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATG
TACCAGCAGCTGGAATCTGAAGGCATCAGTCTTCATCTTAGGGCATCGCTCTTCCTCACACCACGAATCTGAACATGCCT
CTCTCTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAGAAAACACACTCCTTTGCTTAGCCCACAATTCTCC
ATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTACCTGAGGCTGCAATCACACTGAGGA
ACTCACAATTCCAAACATACAAGAGGCTGCCTCTTAACACAGCACTTAGACACGTGCTGTTCCACCTCCCTTCAGACTAT
CTTTCAGCCTTCTGCCAGCAGTAAAACTTATAAATTTTTTAAATAATTTCAATGTAGTTTTCCCGCCTTCAAATAAACAT
GTCTGCCCTCAT

IPD-KIR