Allele Report for 2DS3*0020103


2DS3*0020103
Previous Designations & Local Names: 2DS3_FH15_B_hap
IPD Acc No: KIR00652
Assigned: 31-MAR-2010 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182347  
Cells Sequence Derived From: FH15  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (304 aa)
MSLMVISMACVGFFWLQGAWPHEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGV
SKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHL
STEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKLPFTILLFFLLHRWCSNKKNASVMDQGPAGNRTVNREDSDEQDHQEVSYA
Nucleotide Sequence Data (915 bps)
ATGTCGCTCATGGTCATCAGCATGGCATGTGTTGGGTTCTTCTGGCTGCAGGGGGCCTGGCCACATGAGGGATTCCGCAG
AAAACCTTCCCTCCTGGCCCACCCAGGTCGCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCA
TGTTTGAGCACTTCCTTCTGCACAGAGAGGGGACGTTTAACGACACTTTGCGCCTCATTGGAGAGCACATTGATGGGGTC
TCCAAGGCCAACTTCTCCATCGGTCGCATGAGGCAAGACCTGGCAGGGACCTACAGATGCTACGGTTCTGTTCCTCACTC
CCCCTATCAGTTTTCAGCTCCCAGTGACCCTCTGGACATCGTGATCACAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTCTGGCAGGAGAGAGCGTGACCTTGTCCTGCAGCTCCTGGAGCTCCTATGACATGTACCATCTA
TCCACGGAGGGGGAGGCCCATGAACGTAGGTTCTCTGCAGGGCCCAAGGTCAACGGAACATTCCAGGCCGACTTTCCTCT
GGGCCCTGCCACCCAAGGAGGAACCTACAGATGCTTCGGCTCTTTCCATGACTCTCCCTACGAGTGGTCAAAGTCAAGTG
ACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTAAC
CCCAGACACCTACACGTTCTGATTGGGACCTCAGTGGTCAAACTCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCG
CTGGTGCTCCAACAAAAAAAATGCATCTGTAATGGACCAAGGGCCTGCGGGGAACAGAACAGTGAACAGGGAGGATTCTG
ATGAACAGGACCATCAGGAGGTGTCATACGCATAA
Genomic Sequence Data (15072 bps)
GTTCCGGAGGTTGGATCTGAGACGTGTTTTGAGTTGGTCATAGTGAAGGACACGAGGTGTCAATTCTAGTGAGAACAATT
TCCAGGAAGCCGTGTTCTGCTCTTGAGCGAGCACCCACTGGGCCTCATGAAAGGTAGAAAGAGCCTGCGTACGTCACCCT
CCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGAGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTAGGGGT
GCGGCCGCCTGTCTGCTCCGGCACCACCATGTCGCTCATGGTCATCAGCATGGCATGTGTTGGTGAGTCCTGGAAGGGAA
TAGAGGGAGGGAGCGCGGGGATGGAGATCTGGGCCCAGAGGTGGAGATATAGGCCTGGAGGTGGAGTTATGGGCCTGGAG
TGGAGATATGGGCCTGGAGGTGGAGATATGGACCTGGAGTGGAGATATGAGCCTGGAGTGGAGATATGGGCCTAGAGTGG
AGATATGGGCCTGGAGGTGGAGATCTGGGCCTGGAGTGGAGATCTGGGCCTGGATTGGAGATATGGGCCTGGAGTGGAGA
TATGAGCCTGGAGTGGAGATATGGCCCTGGAGTGGAGATAGGGGCCTGGAGTGCAGATATGGGCCTGGAGTGGAGATGTG
GGTCTGGAGTGCAGATATGGGCCTGGAGGTGGACATAAGGGCCTGGAGTGGAGATATGGGCCTAGAGTGGAGATATGAGC
CTGGAGATGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGGTTGGAGATATGGGCCTGGAGTGGAGATATGGGCC
TGGAGCGGAGATATGGGCGTGGGGTGGAGATATGGGCCTTGAGTGGAGATATGGGACTGAAGTGGAGATATGGGTGTGGG
GTGGAGATATGGGACTGGAGTGCAGATATGGGCATGGGGTGGAGATATGGGACTGGAGTGGAGATATGGGCGTGGAGTGG
AGATATGGGACTGGAGTGGAGATATGGGCGTGGGGTGGAGATATGGGCCTGGAGTGGAGATATGGGCGTGTGGTGAAGAT
ATGGGCCTGGAGTGGAGATATGGGCCTGGAATGGAGATATGGGCGTGGGGTGGAGATATGGGACTGGAGTGGAGATATGG
GCCTGTTGTGGAGATATGGGCTTGGAGTGGAGATATGATCCTGGAATGTAGTTATGGGCCTGGAGGTGGAGATCTGGGCC
CGGGGTGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGAGGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGA
CTGGAGTTATGGGCCTGGGGTGGAGATCTGAGCCTGGATTGCAGATGTGGGCCCAGATTGGCTATATGGGCCTAGGGTGG
GAATATCAGCCTGGAGTGGAGATATGTGCCTGGAGTGGAGATATGGGCTTGGGGTGGGGATATGGGCCTGGAGGCTGGGT
CTCTGCACAGCCGAGAGCCCTGTTCTTGGGTGCAGGTAGGCACTGAGGGTGAGTTTCCCTTCGGCCCAGGAAGGGCCTGG
CTACCAAGACTCACAGCCTAGTGGGGATAGCAAGGGAGGCCTGGTTTGCCTGCAGATGGATGGTCCATCATGGTCTTTCT
TTCCAGGGTTCTTCTGGCTGCAGGGGGCCTGGCCACATGAGGGTAAGTCCTTCTCCAAACCTTAAGGTGTCATCTCCCCA
CATAAGAGGATTTTCCTGAAACGGGAGGGAAGTCCTGTCGGGGAGTCTCTCTTAAACTAGAAAGAGGGGACCCTGGGGTG
CTTGGCCCACAGTTCCGACCTCGCCTCCCCAGCCTTTCATTTCCTTGGCAGAGTCAAGTTCTGTGGGGACCAGGGTTACA
CTAGGGTGCTCAAAGCTGGGTTGTGTGGTGGGGAAGTGGTAGGAACAGCAGATCCTCTGAGGACAAAGGTGTTACTCACA
CACTTCAGCGTTTCCATGATGGTAGGGGCTGCAGTGTGGCTGCTCTCATTCTACCAGAAGAGGTGGGAAACCACAGCCAT
GGCCCTGACATTCCAAATCCTCTGATGGGGGCTCAGTTGTTTATTTTCATTCAGGCATCTGCTGATATTCCATTCTCAAA
GGACATGCCCTCCACCCCATGTCTACCCTGTGTTGTTTTATGTGAGTAATCTTACAGTATTAAAATCTAGTAGGAGTCTC
TTACTCAGCACTTGCTCAAAGTTCTCAGCTGACATTTTTGTTGTAGGGAGACACCTTGTCTTTGTGGGATGAGTCCTTCC
TTTAGCCCTAGGCACCAAGGTGTGATAGCAGCCATAGAAATGTGGAAAGTGGGGAGAATCTTCTGAGCACAGGGAGGGAG
GGGCGGCTGCACATCCTCCTCTCTAAGGTGGCGCCTCCTTCTCCCCAAGGTGGTCAGGACAAGCCCTTGCTTTCTACCTG
GCCCAGCCTTGTGGTGCCTCCAGAACATGTGACTCTTCGGTGTCACTCTAATCTTGGGTTTAACAACTTCAGTCTGTACA
AGGATGATGGGGTGCCTGTCCCTGAACACTACAACAGAATATTCTGGAAAAGCCTTTTCATGGGCCCTGTGACCCCGTCA
CACACAGGGACCTATAGATGCCGGGGTTCACACCCACACTCCCCCAGTGGGTGGTCGGCACCCAGCAACCCCCTGCTGAT
CATGGTCACAGGTCAGAGGGCTCCTGTCTGGGATTCTCCTTGTCCCACCTCCTGAATCCCAGAGCTTCCGGTAGGCATGT
CCTTGAGGGTCCCTTCACGCAGGCCCTGACTGTATTTGGGGTAAAGGGGGATTGAATACAGGGAAATGGGTACTGTGGTG
AGAAGAATAATTGTCCCCAGTGATGACTACATTCTAATCCCTGGAGTCTGTGACTATTTATGTTATAGGGGAAGGGACTG
AAGGGGAAGATGGAGCTCAGGTTGTTGATGAGTTGACCTTGAGATGGGAGAAGGCCTGGACTGTCCCCCTGGGCTCAGTG
TAGTCACAAGGGTCCACATGAAAGGAGGAGGAAGAGGAGAGTGGGGATTAGAGCAGCATAATGGGAGTCTCCATCAGCTT
TGAAGGTGGAGGAAGGCCAGGAGCCATGAATGCAGGTGGCCTATAGAGGCTGGAAAAGTCAAGGAACTGATTCTCCTGAG
TCTCCAGAGGGAACGAAGCCCTGCAGGTGCCTTGATTTTAGCCCAGGAAAAACAGGGCCCGACTTCTGCCTCCAAAAATG
GAAGGGGTCAGTGTGCTCTCTCCTGCTGCCATGCTGCTGATAATTTTCTACAGCAGCAACAGGAAACCAACACCGGAACC
CAGCTCGAGGAAAAGTTAAGAAAGGACACAAGGATAGCCGGGCGTGGTGGCAGGTGCATGTAATCCTAGCGACTTGGGAG
GCTGAGGGCAGGAGAATCACTTGAACCCAGGAGACAGAGGTTGCAGTGAGCCTAGACCACACCACTTCACTCCAGCCTGG
GCAAAGGAGTGAGACTCTGTCTCCAAAATTAATTAATTAAAGAAACCAAACAAGGAGAAGGTTGGCTACACCAAGATCAG
CAAGTGTGGGATTATGATGCCACCACCAGGCTCCATCCACATAGGGAGCGGTTGATACTCCTCCAACCAGCACCAGGAGC
CAGGCTATGGAAGCTGGTACAGGCATGGCAAGAGTGGCTCCCAGTCCCCACCAGGAAAAGGGTGTGTGGACACTGGTGCC
TGCCTTACTGTTCAGTTCATACCTCCTGCCAAGGATTCCAATTCGTCCAAAAGAGATTGAACCAGGCTGCTAAGAGCCTG
GATGTGCAGCCTATCCTGGTTCCTCTTCCACCCCCACATAGACAGCAGGAAAGACATTAGTTCAAAATAGATACAACAGC
CGAAGAGATGAGGCTGAGCCCAGCGGCAAGGCAATCAGAGGTTACTAGAGACAGAGGGACAGAGAAGAGGGAGGGAGACA
GATGGAAGGACCTGCACCAGGAGTTATGGGCACAGAAAAGAACATGAAGACACAGAGAGGAAGGAGAGAGACAGACACCA
GGGAGGGGAAGCCTCACTCAATCCAGGTGCCATGGATGGGATGATAAAGAGAGACACCTTCTAAATTCACAAACTCTCTT
CCTAGGATTCCGCAGAAAACCTTCCCTCCTGGCCCACCCAGGTCGCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAAT
GTTGGTCAGATGTCATGTTTGAGCACTTCCTTCTGCACAGAGAGGGGACGTTTAACGACACTTTGCGCCTCATTGGAGAG
CACATTGATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCGCATGAGGCAAGACCTGGCAGGGACCTACAGATGCTACGG
TTCTGTTCCTCACTCCCCCTATCAGTTTTCAGCTCCCAGTGACCCTCTGGACATCGTGATCACAGGTGAGAGTGTCCAGA
CATTCTTCTCATTGTCATTCGGACACAGAGTGAATGATCCAGGACTTGGAGGCCCAGGTGGTTGTAAGGAAGATGAGCTT
GGTATTCTTATGGAGAGAGACTGACTTGGTGAGGTCTGTACCAACAGAGACAGAGAAACAGGAGACACAAGTACAGACCA
GGTGTCATAACAGAGGACAGACACAGGGGCCATTCCGAGAGTTAGAAAAGACAGAAGGAGTTAAAGGAGACAGACAGACA
GACATGTCCCAGAGAGAGGTGTCCCTCCATGCTGACTTTGCTCAGAGACCTGGCACAGATTACAAGTTTCATTTCTGTTT
TACCTCCACAAAGTGTTCTCTACCAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGG
CCTTCTGGCACCTACAGATGCCGTGTTTATTCTGACACCTCTGCCTTCCAAGTAATGGAGAGTAATCGTCCCAGGATATC
ATGGCCCCAGAACACCAACCCCTGTATGCTGTGTGAACTTGTAGTCTCCAGACTGGATTCTGAGGCTCACATTCCAAATA
ACCCCACATATGAAAGGATCACTGAGAGGCACAGAGAAAAATCAGGAACACCAAAAAGCAAAGACATAAACACACAGAGA
ATGGGCCAGAGGAAGGAGATTGAGAGACTCACAGACACATAAAGAGAGAGAAAAGAGGGCAGAGGAGTGGTGAGAATGAT
GGAAGGGAGCAGAGAAAAGCACTAAAATTAGAGTCCTGAGGGAGAGGCACAAGGACATAGAAAGATGGAGATGTGGGGAT
GAATTGCAGAGATTCCAAAGAGAACTAGAGAGACCGAGAGGCAGAGCAAGACAGATGATAGATGGATAGATATAGATAGA
TGATAAATAGGTAGATGATAGATACTAGGTTATAGATACATAGATGATGATTGATTGATTCATTAATAGATGAGACGTAG
AGATGATGATGAAGACAGATAGATAATACATAGAGATAGAGAGGCAGACAGAAGTCATAGAGAGAGAGATGATACATAGA
TATAGATAACAGATGATTGATGGATAGATAGACAAGTGATAGATACATAGATGATATATAGATATAGATGACAAGTAGAG
AATTTGTAGATAGGCACCGAATAGATAAATAGATAGATCAACAGATAATAGATAGAAATATGCAGAAAGTTATGAACAGG
ACACAAAGTGAGAAACTTAGAATTTAAAAAAGTAACATCAAGTCAACCAATCCAAGGAGAGTCAGAGAGAATAAAACAAT
CCAAAAACGGAAAACATATCTAGAGGTGGGGAAGCGAGGTCAGAGACCTAGAGAGACAGAGAAGGTGGAAGGAGGAAATA
GACATGAAGAGAGATGGGGTGGAGGGTGAGAGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAG
CTCAGGTGAAGGGAGCTGTGACAAGGAAGATCCTCCATAAGGAAAATGCCTCTTCTCCTTCCAGGTCTATATGAGAAACC
TTCTCTCTCAGCCCAGCCGGGCCCCACGGTTCTGGCAGGAGAGAGCGTGACCTTGTCCTGCAGCTCCTGGAGCTCCTATG
ACATGTACCATCTATCCACGGAGGGGGAGGCCCATGAACGTAGGTTCTCTGCAGGGCCCAAGGTCAACGGAACATTCCAG
GCCGACTTTCCTCTGGGCCCTGCCACCCAAGGAGGAACCTACAGATGCTTCGGCTCTTTCCATGACTCTCCCTACGAGTG
GTCAAAGTCAAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAGCCCATGGCTGTCCCATGTCCTATGATCCTAGA
GCCTTAGCTGAGGAGCTTCCTGCTGAGGATGGAGAGAAGCATGGACAGATGCAGAGAGAAGATGCATCCTCGGTGTGAGG
GAGGGATCAGGGCACAGGATGGCCGACAGGGCACCTCCAAACCCTCCTACATGGCCTGCATGGAGGCCCGCAGCCAGGGC
TCCAGGCACCCAGGCAGATGGAGAAAGCGGTCAGGAGAGACCCAGAGGAGGGAGACTGGGCTCAGTTTGGGGAGATCAGA
GGTTCCCTCAGCCCCTCAACCTTACCCATTTCCCAGAAGCCCATCCTGGCCTCTCACCCACACAGAGATGTCATCACCAG
CAACCCCTACACCCTTTACTTTTGTTTGAAGAAATATTTATTGAGGATAAATATACCTATATAGCTTACCACCTTTAACA
TTTTTTTTTTTTTGAGGCAGAGTCTAGCTCTGTCCCCTATGCTGGAGTGCAGTGGCACAATCTCAGCTCACTGCAACTTC
CGCCTCCTGGGTTCAAGCGATTCTCCTGCCTCAGCCACCTGAGTAGCTGGTGCTACAGGTGCGCACCACCACGCCAGGCT
ACTTTTTGTATTTTTAGTAGAGAGGTGGTTTCACCATGTTGGTCGAGCTGGTCTGCAACTCCTGACCACGTGATCCACCC
GCATCTGCCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCACGCCCAGCCACATTTACCATTTTTAAGTGTAAAGTC
TAGTGGTCATAAATACATTTATATATATATATATATATACATTTTTTTTACCCTCCACCCTTTTCTTCCTGCCCTCCAGT
AGCCACCATTCTACTCTCTACCTTCATGAGATCCACCTTTTAGCTCCTGTATATGGGTGAGAAATGGGAATCTTTGTAAT
GACCTCCAGTTCCATCCATGTGGCTGCAAATGACAGGATGTTATTCTTTCTATGGATGAGTAGTCTCCACTGTGCGTATG
TACTACATTCTCTCTATCCATTCACCCACTGATGGGCAGGTAGGTTGACTCCTCATCTTGGCTACTGTGAACAGTGCTGC
ACCAATCATACGAGTGCAGATATCACTTCGATATATTGATTTACTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTG
GATACTATGAAAGTTCTCTTTTTTTTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGCCCAAGCTGGAGTCAAAGT
GGTGCGACCTTGGCTCATTGCAACCTCCGCCTCCTGGGTTCCAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCTGGGAT
TACAGGTGCACGCCACCATGCCTGGCTACTTTTTGGTTTTTTTAGTATAGATGCGGTTTCCCCATGTTGGCTGGGCTGCT
CTCAAACTCATGACCTCAACTGAGGTGCCCGCCTCAGTCTCCCAAAGTGCCGGGATTACAGGCCTGATCCACCACACCCA
ACCTCTTTTTAGTTCTTTAAAGGACTTCCATACTTTTCTCCGTAATCGCTGTACTAATTTACACTCCTCCCAACAGGGTA
CCAGGGTTCTCCTTTCTCTAGCACTTTGCCAGCATTTCTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTATTTCAT
TTTATTTTGAGATGGAGTTTTGCTCTTCTCACCCAGGCTGGAGTGCAGTGGCGCTATCTCGGCTCACCACAACCTCCACC
TCCCAGGTTCAAGCGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGAATTACAGGCACACGCCACCACGCCCGACTAATT
TTTGTATTTTTAGTAGAGACAGCGTTTCTCTATGTGGGTCATACTGGTCTCAAACTCCCGACCTTATGAGATTCACCCAC
CTCAGGCTCTCAAAGTTCTAGGATGACAGACGTGAGCCACCTCACCCGGCCTAAAATCCATTTTAATGGGGTGAGATGAA
AACTCACTTTGATTTTAATTTGCATTTCTCTGATGATGAGTGATACTGAGCACTTTTTCATATGTGGGGAAATTTCATGT
CTTTTGCTCCTTTTTCAATTAAATCATTTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCTAGTTATTAATCCCATCT
CAGATGCATAGTTTGCACATATTTGCTCCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCAGTGCAGA
AGTTGCTTAGTTTGAGGTAATCCCAATGGTCTATTTTTGCTTCGATTACTTGTGTTTTCAAGGTTTAAAACAAAATGTCT
TCCTTCAGACAAACGTCCTGGAGCATTTCCCCAATATTTCTTCTACGTGTTTCATAGGTTCAGGCCTTAGACTCACATCT
TTAATCCATTTTCATTTGATTTTTGTGTATGGTGACAGGTAGAGGTGCAGTTTCATTCCTCTGCATGTAGATGTCCAGGT
TTCCCTGCACTGTTTATTGAAAAGACTGTCCTTTCCTGATTGTGAGTTCTTGGCACCTTTGTCAAAGTCCATTGGATGGG
CTGGGCTTGGTGGCTCACACCTGCAATTCCAGCACTTTGGGAGGCCGAGGCGGGTGGATTACCTGAGGCCAGGAGTTCAA
GATCAGTCTGGCCGACGTGATGAAACATCGTCTCCACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCACCTGTA
ATACCACTACTCAGGAGTTTGAGGCAAGAGAATGATTGAACCCAGGAGGCTGAGGTTGCAGTGAACTGAGATTGCACCTC
TGCACTCCAGCCTGAGTGACAGAGCAAGACTCCATCTCAAAAGAAAAAATAAAAAACCATTGGATGTAAATGCATGGAAT
ATATCTGTGTTATTCATTCTGCTCCATTGTTCTATGTGCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTACTACAGC
TCTGTAACATATTTTGAGATCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTGAAGTCTCAAGACAGTGGGCGTC
ACATACAAAAATTATGGAAAAAAGGATCCCAGGACTCCCAGGGCCCAATATTAGATAACAGAGTGTTGGCCATGAACCAT
CCTCAAAGATTTCCACTGAGTAGAGGACAGACACCCTCATTTCCTCACCTCTCTCCTGTCTCATATTCTAGGAAACCCTT
CAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTGAGTACAGAACCCTCTTATATCCGCTTTTGGAAACC
TGGGGAGGTGGAAACCTTGGATTCAGGCGTTGACTCAGCATCTCACAGCTCTGACATTGTACCCCTGTCTTCCACCATCT
CCGAACTCCAGATACTCCTACAGCGAAAGGGATCTGGGCCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTCATTTTA
TGGAGCTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAATGTTTGTTCTG
CCTGCATTCCTAACTGGAGGATAAATTCCTGGAGACTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGCGAGGTGT
TTTAGAGAAGTTCCACTTGCCAAGGAATGAGCTCCTATAGGTCATGAAGCAACCCTGGCTGACTCAGCAGAGAAAGAGCC
TTGCTGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTCAGGCTG
TGCAGTGTGGAAGCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTTTTTAAT
TATCTTGCAGTGCTGTAGCTCAAAGTATGAAGTGCATCTCACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCTTCCCT
CTGAGGATTCCAGGCAAGAATCTGCTTCTCACTTTTCTCAGCTTCTAGAGGCTCCCACATTCCTTCGCTCCTGGTCCCCT
TCCTCCTTCCTCAAAGCCCACAAAGGCTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACCTCTT
TCTCTGAATGCTGCTCTCCCTTCTTCCTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCAT
CATAATCTCCCGGAAATCATTCAGGATACCCTTGTTTTAAGTTCAGCTGATTAGCAACCATAATTCCATCTGCAATCTTC
ATTCCTCCTTTCCATGTAAAATAAGATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGCATTC
TCCTACCTTCCACAAACAGTGAACAAGATGCATTTGGCCTCTGCTCTTGGGACACTGATATTGCAGATGGTTAAATGGGA
GGGCAGAAAATGAATGCACAAGTGGACCAATAAATGAATGATCCATTGGGAAGCATCTGTGTATGAAATCTATTTGTTTG
TTTCTTCATTTGTTTATTGAGACAGAGTCGCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACCATCTTGGCTCACTGCA
ACCTGCACCTTCTGGATCCAAGTGATTCTCCTGCGTCAGCCTCTCAAGTAGCTGGGATTACAGGCAACTGCCACCATGCC
CGGCTAATTCTTTTTGTATATTTTTTGTAGAGGATGTTTCACCATCTTCGCCAAGCTTCTCTGAAACTCCCAACCTCAAG
TGATCCGACCGTCTCAGCATCCTAAAGTACTGGGATAACTGGCGTGAGCCACTGTGCCCAGCCAGAATTTAAAATAAATA
ATACATAATGCTGAGTGTATGATTTTGGGTGACAGAGAAGATCTCACTAATCAGATATTTGTGACATTAATGAAAAACAC
GGATTGAACCCCTGAAAGATTGGTGGAAGGATTTTCCACACACAGCTGTCAGCCGTGAACGCACAAAGGTGAAAATAATC
TGATGTTGAAGGAAGAGGCTCTTCCTCAAATGCTGGGAATGACGTGGGGAGAATGACAAGACGACTGTGGAGAGACGGAG
AGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACCTCGGGG
TAGCCAGGAATCCCTACATGATTAATAGTGACTGACATGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCTAGGAGA
CCGTGGAAAAGGCAATTCCCGCCTCACTGGTGAAATGTGGTGCTGATTTAGACCCTAACTGGGTGAAGCAGATGGATATA
AGATATGCTTGTGAGGTGGAATCATTGGCTGGAAAGGCTTGCTGGGTATGATTTTCCTAGTTGTCTAATCCTCGCTTAAT
TTCTTTCTGAGCTTTATTCCTACTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGGTGGTGGAAAT
GAAGGGACCTATTACAGCATAATATACAAGTCTGTGAACGGTGGCTCACGCCTGTAACCCAGCACTGCAGGAGGCCAAGG
CGGGTGGATCACACGAAGTCAGCAGTTCGAGACCAGCCTGGCCAACATGGTGAAACCCTGTCTCTAGGAAAAACACAAAA
ATTAGCCGAACATGGTGGTGCATCCCTGTAATGCCAGCTCCTACTCTGGAGGATGAAGCAGGAGAATGACTTCAACCCAG
GAGGTGGAGTTTGCAGTGAGTGGAGATTGCATCACTGCACTCCAGCCTGGGTGACACAAGGAGACTCCGTCTCAAAAAAT
AAAAATAAGAAATGCATAAATATAAATATAATATAACACACGCAAATGACAAAGGGACCTGAATTCCAATCATGATTTTT
CTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATGAGCCTAAAACCTCTTCCCTATTTGGCTT
TCTGTGAGCATGAGATCATATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCACAGATCCTGGAATACACAAAGTGCTC
TGTTCATCACAAAAAAAACATGCCCTCTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCATCTGTGGAGATTCAGA
TAGGCCATGGGGAGGTAAATTCTAATACTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATCAGCGTCAGCACTAGCT
CCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTATTGAAGCAATAGATGGCCGAGGGTGTGGTCCTTCCCCC
AGCCTCTGGGGTAGAACAGCAGCCTAACATGTGTCTCCTGAGATCACAAAGAGTAGCACGTTTCACATGGGCTTCAACAC
TATTTCCTGGCCATTTGACATAAGAGAATTCTACTTCGCTTTTTTTATCTTGATTTCACTTTTGTTTCCTTTTCTTGGAG
AATGCAAGTTGTTTGACTCAAGAATGCCGTGGATGTATAAATCCTAAAGCACATTCGCTGTGTATCAATCCCAGTGCAGT
CTTCCCAGAGAAGACTCTAAACACCTCCTGGACTGCACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTCCAGGA
AGACAGAACACACAGAGAATACATTACACAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTACA
TTTCAATGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTGCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAGCTGGG
GGAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGCCT
TCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGAGACATTCCTCCTGATCTCAGGACGTTGCTGTCGTAGTTTT
TTTTTGTTGCTCTAAAGGAAAACTTGAGCCTCGGTAACTTCTAAAGAAAAGAGATCGGTTTGCCTCACCGTTCTGCAGGC
TGTACTGGAAGCATGGCACCAGAATCTATTTCTTGTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGT
CTGTCTGTGCAGAGACCGCAGAGATCACACGGCAAGAGAGAGAGTAAGGGGGAGGGGGAGCGATGGAGCTTCCAAGCTCT
TTTGAACAACCAGCTCTCCGGGAACTAATAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGTTCTGTTCA
TGATGGATCCACCTCCATGACCCAAACACCTCCCAAGAGGCCCAACCTCCCACAGTGGGGGTGAAATTTCCATGTGAGGT
TTGAAGGGGTCAGACATCTCAACTAAAGTAGTTGTATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAATTGAGAA
AGCAGGGGAAAGCTAGGTCTCCCACCATTTGGGTGCTTGTCCTAAAGAGACGTTGTATGTGGTTACCTGTCAATCAAGAA
ATGCGAGACAATTCATAAAGAGGAACTGCTATGATTAGCTTCTTATTGGTGTCTCCTCTTCTTCCAGGTAACCCCAGACA
CCTACACGTTCTGATTGGGACCTCAGTGGTCAAACTCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCT
CCAACAAAAAAAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGTAGCACGCGGG
TGTGTGTTCCTCACAGGCAGGATGGTCCCTGGCCCAAGGCAGGAGCCACAGAGGCAGGACTTTCTAGAGAGAGCACCAGA
TTCCCTTCCCCTGCCTTCAGCTCACAGACCATTGCCTGATTCTGAACTGTACCCTCACGTCCCCTGCAGCCACTCACATC
CAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGAGATAGAATCAATGGGATGGGAACTCAGAGCTATTCATGGGATGGGT
CCTTGAGCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGGCACCTATGGCCTCCCCCTGTT
TGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTGTTTTGTTGACTTCCATCTTCTACAGATGCAT
CTGTAATGGACCAAGGGCCTGCGGGGAACAGAACAGTGAACAGGGAGGTAGGTGCTCCTCGGCCCAGCCTCGTGGCTAGT
CTTATTCCCAAAGAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGATTCTGATGAACAG
GACCATCAGGAGGTGTCATACGCATAATTGGATCACTGTGTTTTCACACAGAGAAAAATCACTCCCCCTTCTCAGAGGCC
CAAGACACCCCCAACAGATACCAGCATGTACATAGAACTTCCAAATGCTGAGTCCAGATCCAAAGCTGTCTTCTGTCCAC
GAGCACCACAGTCAGGCCTTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATGT
ACCAGCAGCTGGAATCTGAAGGCATCAGTCTTCATCTTAGGGGATCGCTCTTCCTCAAACCACGAATCTGAACATGCCTC
TCTCTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAGAAAACACACTCCTTTGCTTAGCCCACAATTCTCCA
TTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTACTTGAGGCTGCAATCACACTGAGGAA
CTCACAATTCCAAACATACAAGAGGCTCCCTCTTAACACAGCACTTAGACACGTGCTGTTCCACCTTCTCTCATGCAGTT
CCACCTCCCCTCAGACTATCTTTCAGCCTTCTGTCAGCAGTAAAACTTATAAATTGTTTTTAGTAATTTCAATGTAGTTT
TCCCTCCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR