Allele Report for 2DS2*0010111


2DS2*0010111
Previous Designations & Local Names: 2DS2_FH13_BA2_hap
IPD Acc No: KIR00623
Assigned: 31-MAR-2010 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182345  
Cells Sequence Derived From:  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 0 Laboratories: 1
Protein Sequence (304 aa)
MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGV
SKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHL
SREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA
Nucleotide Sequence Data (915 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACATGAGGGAGTCCACAG
AAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCA
GGTTTGAGCACTTCCTTCTGCACAGAGAGGGGAAGTATAAGGACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTC
TCCAAGGCCAACTTCTCCATCGGTCCCATGATGCAAGACCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTC
CCCCTATCAGTTGTCAGCTCCCAGTGACCCTCTGGACATCGTCATCACAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTTTGGCAGGAGAGAGCGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTA
TCCAGGGAGGGGGAGGCCCATGAACGTAGGTTCTCTGCAGGGCCCAAGGTCAACGGAACATTCCAGGCCGACTTTCCTCT
GGGCCCTGCCACCCACGGAGGAACCTACAGATGCTTCGGCTCTTTCCGTGACTCTCCCTATGAGTGGTCAAACTCGAGTG
ACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTAAC
CCCAGACACCTGCATGTTCTGATTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCG
CTGGTGCTCCAACAAAAAAAATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGATTCTG
ATGAACAAGACCATCAGGAGGTGTCATACGCATAA
Genomic Sequence Data (14546 bps)
GTATGAGAGGTTGGATCTGAGACGTCTTTTGAGTCTGGTCGTAGTGAAGGACGCAAGGTGTCAATTCTAGTGAGAACAAT
TTCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCC
TCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGC
GCGGCCGCCTGTCTGCACAGACAGCACCATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAA
TCGAGGGAGGGAGTGCGGGGATGGAGATCGGGGCCCAGAGTTGGAGATATAGGCCTGGAAGTGGAGTTATGGGCCTAGAG
ATGGAGTGATGGGCCTAGAAGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGGTTGAGATATGGGCCTGCAGT
AGAGATATGGGCTTGTAGTGGAGACATGGGCCTGGAGATGGAGATATGGGCCTGGAGATGGAGATATGGGCCTGCAGTAG
AGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGATCTGGAGGTGGAGATACGGGCCTGCAGTAGAGA
TATGGGCCTGGAGTGGAGATATGGGCCAGGAGTGGAGTTATGGGCCTAGAGGTGGATATCTGGGCCTGGAGTGGAGATAT
GGGCCTAGGAAGGAGATATGGGCCTGGGTGTGGAGATATGGGACTGGAGAGGTGATATGGGCCTGGAGTGGAGATATGGG
CTTAGGGTGGAGATCTGGGCCTGGGGCAGAGATATGGGACTGGATTGGAGATATGGGCCTAGGGTGGAAATATCAGCCTG
GAGTGGAGATATGGGCTTGTGGTGGGGATCTGGGCCTGGAAACTGGGTCTCTGCACAGCCGACAGCCCTGTTCTTGGGTG
CAGGTAGGCACTGAGGGTGAGTTTAACTTCAGCCCAGGAAGGGCCTGGCTGCCAAGACTCACAGCCCAGTGGGGGCAGCA
AGGGAGTCCTGGTTTGCCTGCAGATGGATGGTCCATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGG
CCACATGAGGGTGAGTCCTTCTCCAAACCTTCGGTTGTCATCTCCCCACATAAGAGGATTTTCCTGAAACAGGAGGGAAG
TCCTGTCAGGGAGTCTCTCATAAACTGGGAAGAGAGGACCCTGGGGTGCTCGGCCCACATTTCTGACCTTGCCTCCCTGG
CCTCTCAACCCCTTGGCAGAGTCAAGTTCTGTGGGGACCAGGGTTAGACTGGGGTGCTCAAAGCTGGGGTGTGTGGTGGG
GAAGTGGTAGGAACAGCAGATCCTCTGAGGACAAAGGTGTTACTCACACACTTCAGCGTTTCCATGATGGTAGGGGCTGC
AGTGTGGCTGCTGTCATTCTACCAGAAGAGGTGGGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGATGGGGGC
TCAGTTGTTTATTTTCGTTCAGGCATCCGCTGATATCCACTCACAAAGGACATGCCCTCCACCTCATGTCTACCCTGTGT
TGTTTTATGTGAGTAATCTTACAGTATTAAAATCTAGTAGGAGTCTCTTTACTCAGCACTTGCTCAAAGTTCTCAGCTGA
GGCTTTTGTTGTAGGGAGACACCATGTCTTTGCGGGATGGGTCCTTCCTTCAGCCCTGGGCACCAAGGTGTGATAGTAGC
CATAGAAACGTGGAAAGCGAGGAGAATCTTCTGAGCACAGGGAGGGAGGGGCAGTTCCACATCCTCCTCTCTAAGGCGGC
GCCTCCTTCTCCCCAAGGTGGTCAGGACAAGCCCTTGCTGTCTGCCTGGCCCAGCCTTGTGGTGCCTCTAGGACATGTCA
TTCTTCGGTGTCACTCTTATCTTGGGTTTAACAACTTCAGTCTGTACAAGGAAGGTGGGGTGCCTGTCCCTGAGCTCTAC
AACAGAATATTCTGGAACAGCCTTTTCATGGGCCCTGTGACCCCCGCACAACAGGGACATACAGATGTCGGGGTTCACAC
ACACACTCCCCCAGTGGGTGGTCAGCACCCAGCAACCCCCTGGTGATCGTGGTCATAGGTCAGAGGGCTCCTGTCTTGGA
TTCTCCTTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGCATGTCCTTGAGGGTCCCATCACGCAGGCCCTGACTGT
ATTTGTGGTAAAGGGGGATTGAATACAGGGAAATGGGTGCTGTGGTGGGAAGAATAATTGTCCCCAGTGATGACTACATT
CTAATCCCTGGAGTCTGTGACTATGTATGTTATAGGGGAAGGGACTGAAGGGGAAGATGGAGCTCATGGGGAGACAGCCT
GGACTGTCCCACTGGGCTCAGTGTAATCACAAGGGTGCACATGAAAGGAGGAGGAAGAGGGGAGTGGGGATTAGAGCAGT
CCAGTGGAAGTCTTCACCAGCTTTGAAGGTGGAGGAAGGCCAAGAGCCATGAATGCAGGTGGCCTATAGAGGCTGGAAAA
GTCAAGGAACTGATTCTCCAGAGTCTCCAGAGGAAACGAAGCCCTGCAGATGCCTTGATTTTAGCCCAGGAAAAATAGGG
TCCAATTTCTGTCTCCAGTACTGGAAGGTGTCAGTGTGGTCTCTCCTGCTTCCATGCTTCTGATAATTTTGTACAGCAGC
AACAGGAAACCAACACTGGAACCCAGGTCAAGGACAAGTTAAGAAACAACCCAAGGAAAGCCAGGCATGGTGGCAGGCGC
ATGTAATCCTAGCGACTCAGGAGGCTGAGGGCAGGAGAATCACTTGAACCCAGGAAACAGAGGTTGCAGTGAGCCTAGAC
CACACCACTTCACTCCAGCCTGGGTGAAGGAGTGAGACTCTGTCTCCAAAATTAATTAATTAATTAAAGAAACCAAACAA
GGAGAAGGTTGGCTACCCTGAGATCAGCAAGGGTGGGATGATGATGCCACCACCAGGCTCCATCCACATAGGGAGGGGTT
GATACTCCTCCAACCAGCACCAGGAGCCAGCCTATGGAAGCTGGCACCATGGAGAAGGCACAGGCATGGCAAGAGTGGCT
CCCAGTCCCGACCAGGAACAGGGTGTGTGGACACTGGTGCCTGCCTTATTCATCAGTTCATACCTTCTGCCAAGGATTGC
AATTCATCCAAAAGAGATTGAACAAGGCTGATAAGAGCCTGGATGTGCAGCCTATCCTGGTTCCTCTTTCACCCCCACAT
AAACAGCAGGAAAGACGTTAGTGTGAAATAGATACAACACCCCAAGAGATGAGGCTAAGCCCAGTGGGAAGGGAATCAGA
GGCTACTAGAGACAGAGGGACAGAGAAGAGGGAGGGAGACAGATGGAAGGACCTGCACCAGGAGTTATGGGCACAGAAAA
GAACATGAAGACACAGAGAGGAAGGAGAGAGACAGACACCAGCAAGGGGAAGCCTCACTCATTCTAGGTGCCATGGATGG
GATGATAAAGAGAGACACCTTCTAAACTCACAACCTCTCTTCTTAGGAGTCCACAGAAAACCTTCCCTCCTGGCCCACCC
AGGTCCCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCAGGTTTGAGCACTTCCTTCTGCACA
GAGAGGGGAAGTATAAGGACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGT
CCCATGATGCAAGACCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTCCCCCTATCAGTTGTCAGCTCCCAG
TGACCCTCTGGACATCGTCATCACAGGTGAGAGTGTCCGGACATTCTCATTGTCATTGGGCTGCAGAGTGAATGATCCAC
GACTTGGAACCCCCAGGTAGTTGTAAGGAAGATGAGCTTGGTATTCTTATGGAGAGAGACTGACTTGCTGAGGTTTGTAC
CAACAGAGACAGAGAAACAGGAGACACAAGTACAGACCAGGTGTCATAACGGAGGACAGACACAGGGGCCATACAGGGAG
TTAGAAAAGACAGAAAGAGTTAAAGGAGACAGACAGACAGACATGTCCCAGAGAGAGGTGTCCCTCCATGCTGACTTTGC
TCACAGACCTGGCACAGGATAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTGTTCTCTACCAGGAGAACCCAAGGACA
CCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCACCTACAGGCCATGTTTATTCTGACACCTCTG
CCTTCCATGTAATGGAGAGTAACCGTCCCAGGATATCATGGCCCCAGAACACCAACCCCTGTATGCTGTGTGAACTTGTG
GTCTCCAGACTGGATTCTGAGGCTCACATTCCAAATAACCCCACATATGAAAGGATCACTGAGAGGCACAGAGAGAAATC
AGGAACACCAAAAAGCAAAGACATAAACACACAGAGAATGGGCCAGAGGAAGGAGATTGAGAGACTCACTGACACATAAA
GAGAGAGAAAAGAGGGCAGAGGAGTGGTGAGAATGATGGAAGGGAGCAGAGAAAAGCACTAAAATTAGAGTCCTGAGGGA
GAGGCACAAGGACATAGAAAGATGGAGATGTGGGGATGAACTGCAGAGATTCCAAAGAGAACTAGAGAGACCGAGAGGCA
GAGCAAGACAGATGATAGATGGATAGATATAGATAGATGATAAATAGGTAGATGATAGATAATAGGTTAAAGATACATAG
ATGATGATTGATTGATTCATTAATAGATAATACATAGAGATGATGATGATGAAGACAGATAGATAATACGTACAGATAGA
GAGGCAGACAGAAATCATAGAGAGAGAGATGATACATACATATAAATAACAGATGATTGATGGATAGATAGACAACTGAT
AGATACATAGATGATATATAGATATAGATGACAGGTAGAGAATTTGTAGATAGGCACCGAATAGATAAATAGATAGATCG
ACAGATAATAGATAGAAATATGCAGAAAGTTATGAACAGGACACAACGTGAGAAACTTAGAATTTAAAAAAGTAACATCA
AGTCAACCAATCCAAGGAGAGTCAGAGAGAATAAAAGAATCCAAAAAGGGAAAACATATCTAGAGGTGGGGAAGCGAGGT
CAGAGACCTAGAGAGACAGAGAAGGTGGAAGGAGGAAATAGACATGAAGAGAGATGGGGTGGAGGGTGAGAGAGAGAGAG
AGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTGAAGGGAGCTGTGACAAGGAAGATCCTCCCTGA
GGAAAATGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTTTGGCAGGA
GAGAGCGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTATCCAGGGAGGGGGAGGCCCATGAACG
TAGGTTCTCTGCAGGGCCCAAGGTCAACGGAACATTCCAGGCCGACTTTCCTCTGGGCCCTGCCACCCACGGAGGAACCT
ACAGATGCTTCGGCTCTTTCCGTGACTCTCCCTATGAGTGGTCAAACTCGAGTGACCCACTGCTTGTTTCTGTCACAGGT
GAGGAAACCCCATATCTGTCTCATGTCCTATGATCCTAGAGCCTTAGCTGAGGAGCTTCCTGCTGATGATGGAGAGAAGC
ATGGACAGATGCAGAGAGAAGACGAAGCTTGGGTGTGAGGGAGGGATCAGGGCACAGGATGGCAGACAGGGCACCTCCAA
ACCCTCCTACACGGCCTGCATGAAGGCCCGCGGCCAGGGCTCCAGGCACACAGGCAGATGGAGAAAACGGTCAGGAGAGA
CCCAGAGGAGAGAGACTGGGCTCAGTTTGGGAAGATCAGAGGTTCCCTCAGCCCCTCAACATTATCCATTTCCCAGAAGC
CCATCCTGGCCTCTCACCCACACAGGGATGTCATCACCAGCAACCCCTACACCCTTTACTTTTGTTTGAAGAAATATTTA
TTGAGGATAAATATACCTATATAGCTTACCACCTTTAACATTTTTTTTTTTTTTGAGGCAGAGTCTAGCTCTGTCCCCTA
TGCTGGAGTGCAGTGGCACAATCTCAGCTCACTGCAATTTCCGCCTCCTGGGTTCAAGCGATTCTCTTGCCTCAGCCACC
TGAGTAGCTGGTGCTACAGGCGCGCACCACCACGCCAGGCTACTTTTTGTATTTTTAGTAGAGAGGTGGTTTCACCATGT
TGGTCGAGCTGGTCTCCAACTCCTGACCACGTGATCCACCCGCATGTGCCTCCCAAAGTGCTGGGATTACAGGCATGAGC
CACCACGCCCAGCCACATTTACCATTTTTAAGTGTAAAGTCTAGTGGTCATAAATACATTTATATATATATATATATTTT
TTTTTTTTTTACCCTCCACCCTTTTCTTCCTGGCCTCTGGAAGCCATCATTCTACTCTCTACCTTCATGAGATCCACCTT
TTAGCTCTGTATATGGGTGAGAAATGGGAATCTTTGTAATGACTTCCAGTTCCATCCATGTGGCTGCAAATATCAGGATG
TTATTCTTTCTATGGATGAGTAGTCTCCACTGTGCGTATGTACTACATTCTCTCTATCCATTCATCCACTGATGGGCAGG
TAGGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGCACCAATCATACGAGTGCAGATATCACTTCGATATATTGAT
TTACTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGATACTATGAAAGTTCTCTTTTTAGTTTTTCGTTTGTTGT
TTTGTTTTTGTTTTTGAGACAGTTTCCCTCTGTGCCCAGGCTGGAGTACAAGTGATGTCATCTTGGCTCATTGCAACCTC
TGCCTCCTGGGTTCAAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCTGGGATTACAGGTGCACGCCACCATGCCTGGCT
ACTTTTTGTTTTTTTTAGTATAGATGGGGTTTCCCCATGTTGGCTGGGCTGCTCTCAAACTCATGACCTCAACTGAGATG
CCCGCCTCAGTCTCCCAAAGTGCTGGGATTACAGGCCTGATCCACCACACCCAACCTCTTTTTAGTTCTTTAAAGGACTT
CCATACTTTTCTCCGTAATCGCTGTACTAATTTACACTCCTCCCAACAGGGTACCAGGGTTCTCCTTTCTCTACCACCTT
GCCAGCATTTCTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTTATTTCATTTTATTTTGAATGGAGTTTTGCTCTT
CTCACCCAGGCAGGAGTGCAGTGGCGCTATCTCGGCTCACCACAACCTCCACCTCCCAGGTTCAAGCGATTCTCCTGCCT
CAGCCTCCCGAGTAGCTGGAATTACAGGCACACTCCACCACGCCCGACTAATTTTTGTATTTTTAGTAGAGACAGTGTTT
CTCTATGTGGGTCAGACTGGTCTCAAACTCCTGACCTTATGAGATTCACCCACCTCAGGCTCTCAAAGTTCTAGGATGAC
AGACGTGAGCCACCACGCCCGGCCTAAAAGCCATTTTAATGGGGTGAGATGAAAACTCACTTTGATTTTAATTTGCGTTT
CTCTGATGATGAGTGATACTGAGCACTTTTTAGTATGTGGGGAAATTTCATGTCTTCTGCTCCTTTTTCAATTAAATCAT
TTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCTAGTTATTAATCCCATCTCAGATGCATAGTTTGCACATATTTGCT
CCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCAGTGCAGAAGTTGCTTAGTTTGAGGTAATCCCAAT
GGTCTATTTTTGCTTCGATTACTTGTGTTTTCAAGGTTTAAAACAAAATGTCTTTCTTCAGACAAATGTCCTGGAGCATT
TCCCCAATATTTTGTTCTACGTGTTTCATAGGTTCAGGCCTTAGACTCACATCTTTAATCCATTTTCATTTGATTTTTGT
GTATGGTGACAGGTAGAGGTGCAGTTTCATTCCTCTGCATGTCGATGTCCAGGTTTCCCTGCACTGTTTATTGAAAAGAC
TGTCCTTTCCTGATTGTGAGTTCTTGGCACCTTTGTCAAAGTCCATTGGATGGGCTGGGCTTGGTGGCTGACACCTGCAA
TTTCAGCACTTTGGGAGGCCGAGGCGGGTGGATTACCTGAGGCCAGGAGTTCAAGATCAGTCTGGACGACGTGATGAAAC
ATCGTCTCCACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCACCTGTAATACCACTACTCAGGAGTTTGAGGCA
AGAGAATGATTGAACCCAGGAGGCTGAGGTTGCAGTGAACTGAGATTGCACCTCTGCACTCCAGCCTGAGTGACAGAGCA
AGACTCCATCTCAAAAGAAAAAATAAAAAACCATTGGATGTAAATGCATGGAATATATCTGTGTTATTCATTCTGCTCCG
TTGTTCTATGTCCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTACTACAGCTCTGTAACATATTTTGAGATCAGGTA
GTGTGATGCTCCTGTTTTCTCTTTATACCTTGAAGTCTCAAGACAGTGGGCGTCACATAAAAAAATTATGGAAAAAAGGA
TCCCAGGACTCCCAGGGCCCAATATTAGATAACAGAGTGTTGGCCATGAACCATCCTCAAAGATTTCCACTGAGTAGAGG
ACAGACACCCTCATTTCCTCACCTCTCTCCTGTCTCATGTTCTAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAA
CCAAGCTCCAAAACCGGTGAGTACAGAACCCTCTTATATCCGCTTTTGGAAACCTGGGGAGGTGGAAACCTTGGATTCAG
GCGTTGACTCAGCATCTCACAGCTCTGACATTGTACCCCTGTCTTCCACCATCTCCGAACTCCAGATACTCCTACAGCGA
AAGGGATCTGGGTCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTCATTTTATGGAGCTGAGACTTCCTACAAGCTAG
AAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAATGTTTGTTCTGCCTGCATTCCTAACTGGAGGATAAAT
TCCTGGAGACTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGCGAGGTGTTTTAGAGAAGTTCCACTTGCCAAGGA
ATGAGCTCCTATAGGTCATGAAGCAACCCTGGCTGACTCAGCAGAGAAAGAGCCTTGCTGTAACAGAGAACAGAGCTCAT
GCACGCACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTCAGGCTGTGCACTGTGGAAGCTTTTCCTATTGT
TGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTTTTTAATTATCTTACAGTGCTGTAGCTCAAAGT
ATGAAGTGCATCTCACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCTTCCCTCTGAGGATTCCAGGCAAGAATCTGCT
TCTCACTTTTCTCAGCTTCTAGAGGCTCCCACATTCCTTCGCTCCTGGTCCCCTTCCTCCTTCCTCAAAGCCCACAAAGA
CTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACCTCTTTCTCTGAATGCTGCTCTCCCTTCTTC
CTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCATCATAATCTCCCGGAAATCATTCAGGA
TACCCTTGTTTTAAGTTCAGCTGATTAGCAACCATAATTCCATCTGCAATCTTCATTCCTCCTTTCCATGTAAAATAAGA
TATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGCATTCTCCTGCCTTCCACAAACAGTGAACAA
GATGCATTTGGCCTCTGCTCTTTGGACACTGATATTGCAGATGGTTAAATGGGAGGGCAGAAAATGAATGCACAAGTGGA
CCAATAAATGAATGATCCATTGGGAAGCATCTGTGTATGAAATCTATTTGTTTGTTTCTTCATTTGTTTATTGAGACAGA
GTCTCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACCATCTTGGCTCACTGCAACCTGCACCTTCTGGATCCAAGTGAT
TCTCCTGCGTCAGCCTCTCAAGTAGCTGGGATTACAGGCAACTGCCACCATGCCCGGCTAATTCTTTTTGTATATTTTTT
GTAGAGGATGTTTCACCATCTTCGCCAAGCTTCTCTGAAACTCCCAACCTCAAGTGATCCGACCGTCTCAGCATCCTAAA
GTACTGGGATAACTGGCGTGAGCCACTGTGCCCAGCCAGAATTTAAAATAAATAATACATAATGCTGAGTGTATGATTTT
GGGTGACAGAGAAGATCTCACTAATCAGATATTTGTGACATTAATGAAAAACACGGATTGAACCCCTGAAAGATTGGCGG
AAGGATTTTCCACACACAGCTGTCAGCCGTGAAGGCAGAAAGCTGAAAACAATCTGATGTGGAAGGAAGAGGCTCTGCCT
CAAATGCTGGGAATGAGGTGGGGAGAATGACAAGACGACTGTGGAGAGACGGAGAGCACACTGGGTACACAGGAAACTAA
GGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACCTCGGGGTAGCCAGGAATCCCTACATGATTAAT
AGTGACTGACATGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCTAGGAGACTGTGGAAAAGGCAATTCCCGCCCCA
CTGGTGAAATGTGGTGCTGATTTAGACCCTAACTGGGTGAAGCAGATGGATATAAGCTATGCTTGTGAGGTGGAATCATT
GGCTGGAAAGGCTTGCTGGGTATGATTTTCCTAGTTGTCTAATCCTCGCTTAATTTCTTTCTGAGCTTTATTCCTACTAC
ACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGGTGGTGGAAATGAAGGGACCTATTATAGCATAATATA
CAAGTCTGTGAACGGTGGCTCACGCCTGTAACCCAGCACTGCAGGAGGCCAAGGCGGGTGGATCACATGAAGTCAGCAGT
TCGAGACCAGCCTGGCCAACATGGTGAAACCCTGTCTCTAGGAAAAACACAAAAATTAGCCGAGCATGGTGGTGCATCCC
TGTAATCCCAGCTCCTACTCTGGAGGATGAAGCAGGAGAATGACTTCAACCCAGGAGGTGGAGGTTGCAGTGAGTGGAGG
TTGCATCACTGCACTCCAGCCTGGGTGACACAAGGAGACTCCGTCTCAAAAAATAAAAATAAGAAATGCATAAATATAAA
TATAATATAACACATGCAAATGAGAAAGGGACCTGAATTCCAATCATGATTTTTCTATTTCTCTATAATTACTTCTTTGA
TCCTTTATCTTATCCATTAGGCAATGAGCCTAAAACCTCTTCCCTATTTGGCTTTCTGTGAGCATGAGATCATATAGAAA
ATGTGAAAGCCCGCTGAATCCTCCAGCACAGATCCTGGAATACACAAAGTGCTCTGTTCATCACAAGAAAACATGCCCTC
TCACCCAAATCCCCCACCTCACCCCTACTTCCAATCATCTGTGGAGATTCAGATAGGCCATGGGGAGGTAAATTCTAATA
CTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATTAGCGTCAGCAGTAGCTCCTGCTCCCCTTTCCTACTAATTCACA
GGAGGACAGGTGGTATTGAAGCAATAGATGGCCGAGGGGGTGGTCCTTCCCCCAGCCTCTCGGGTAGAACAGCAACCTAA
CATGTGTCTCCTGAGATCACAAAGAGTAGCACGTTTCACATGGGCTTCAACACTGTTTCCTGGCCATTTGACATAAGAGA
ATTCTACTTCGCTTTTTTTATCTTGATTTCACTTTTGTTTCCTTTTCTTGGAGAATGCAAGTTGTTTGACTCAAGAATGC
CGTGGATGTAGAAATCCTAAAGCACAGTCGCTGTGTATCAATCCCAGTGCAGTCTTCCCAGAGAAGACTCTAAACACCTC
CTGGACTGCACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAATACATTAC
ACAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTACATTTCAATGTGAGCCAGTCCCTCAAGGC
TCAGAAAAGCTGCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAGCTGGGGGAAGCCAGAAAGCAGCCCAGCCTGGG
TTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGCCTTCCTCCAGGAAGAACAGGAAGACAGCC
CAGGCTGTTCTGAGACATTCCTCCTGATCTCAGGTCGTTGCTGTCTTAGTTTTTTTTTTTGTTGCTCTGAAGGAACACTT
GAGCCTCGGTAACTTCTAAAGAAAAGAGATCGGTTTGCCTCACAGTTCTGCAGGCTGTACTGGAAGCATGGCACCAGAAT
CTATTTCTCGTGATGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCACAGAGAT
CACACGGCAAGAGAGAGAGTAAGGGGGAGAGGGAGCAATGGAGCTTCCAAGCTCTTTTTAACAACCAGCTGTCCAGGAAC
TAACAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGATCTGTTCATGATGGATCCACCTCCATGACCCAA
ACACCTCTGAAGAGGCCCAACCTCCCACAATGGGGGTGAAATTTCAATGTGAGGTTTGAAGGGGTCAAACATCTCAACTA
AAGTAGTTGTATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAATTGAGAAAGCAGGGGAAAGCTAGGTCTCCCGC
CATTTGGGTGCTTGTCCTAAAGAGACGTTGTATGTGGTTACCTGCCAATCAAGAAATGCGAGACAATTCATAAAGAGGAA
CTGCTATGATTAGCTTCTTATTGGTGTCTCCTCTTCTTCCAGGTAACCCCAGACACCTGCATGTTCTGATTGGGACCTCA
GTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCTCCAACAAAAAAAGTAAGTCTCACGA
AGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCACTCAGGTGTGTGTTCCTCACCAGCAGGATGG
TCCCTGGCCCAAGACAGGAGCCACAGAGGCAGGACTTTCTAGAGAGAGCACCAGATTCCCTTCCCCTGCCTTCAGCTCAC
AGACCGTTGCCTGATTCTGAACTGTACCCTCACGTCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGACAGGCAG
AAAGTGGGAGATAGAATCAATGGGATGGGAACTCAGAGCTATTCATGGGATGGGTCCTTGAACTCAGAGAGATAGAATGT
CTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGGCACCTATGGCCTCCCCCTGTTTGTTGGTATCTGCTTATGAAATGAG
GACCCAGAAGTGCCCTCCGAGCTCTTTTGTTGACTTCCGTCTTCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCAGG
GAACAGAACAGTGAACAGCGAGGTAGGTGCTCCTCGGCCCAGCCTCGTGGCTAGTCTTATTCCCAAAGAGTCCTGAAAAA
TGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGATTCTGATGAACAAGACCATCAGGAGGTGTCATACGCAT
AATTGGATCACTGTGTTTTCACACAGAGAGAAATCACTCGCCCTTCTGAGAGGCCCAAGACACCCCCAACAGATACCAGC
ATGTACATAGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTTCTGTCCACGAGCACCACAGTCAGGCCTTGAGGG
GATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATGTACCAGCAGCTGGAATCTGAAGGCAT
CAGTCTTCATCTTAGGGCATCGCTCTTCCTCACACCACGAATCTGAACATGCCTCTCTCTTGCTTACAAATGTCTAAGGT
CCCCACTGCCTGCTGGAGAGAAAACACACTCCTTTGCTTAGCCCACAATTCTCCATTTCACTTGACCCCTGCCCACCTCT
CCAACCTAACTAGCTTACTTCCTAGTCTACCTGAGGCTGCAATCACACTGAGGAACTCACAATTCCAAACATACAAGAGG
CTCCCTCTTAACACAGCACTTAGACACGTGCTGTTCCACCTCCCTTCAGACTATCTTTCAGCCTTCTGCCAGCAGTAAAA
CTTATAAATTTTTTAAATAATTTCAATGTAGTTTTCCCGCCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR