Allele Report for 2DS2*0010110


2DS2*0010110
Previous Designations & Local Names: T7526_Bdel_hap
IPD Acc No: KIR00451
Assigned: 28-AUG-2009 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182359  
Cells Sequence Derived From: T7526  
Known Ethnic Origin Of Source: Oriental
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (304 aa)
MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGV
SKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHL
SREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA
Nucleotide Sequence Data (915 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACATGAGGGAGTCCACAG
AAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCA
GGTTTGAGCACTTCCTTCTGCACAGAGAGGGGAAGTATAAGGACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTC
TCCAAGGCCAACTTCTCCATCGGTCCCATGATGCAAGACCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTC
CCCCTATCAGTTGTCAGCTCCCAGTGACCCTCTGGACATCGTCATCACAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTTTGGCAGGAGAGAGCGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTA
TCCAGGGAGGGGGAGGCCCATGAACGTAGGTTCTCTGCAGGGCCCAAGGTCAACGGAACATTCCAGGCCGACTTTCCTCT
GGGCCCTGCCACCCACGGAGGAACCTACAGATGCTTCGGCTCTTTCCGTGACTCTCCCTATGAGTGGTCAAACTCGAGTG
ACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTAAC
CCCAGACACCTGCATGTTCTGATTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCG
CTGGTGCTCCAACAAAAAAAATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGATTCTG
ATGAACAAGACCATCAGGAGGTGTCATACGCATAA
Genomic Sequence Data (14547 bps)
GTATGAGAGGTTGGATCTGAGACGTCTTTTGAGTCTGGTCGTAGTGAAGGACGCAAGGTGTCAATTCTAGTGAGAACAAT
TTCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCC
TCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGC
GCGGCCGCCTGTCTGCACAGACAGCACCATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAA
TCGAGGGAGGGAGTGCGGGGATGGAGATCGGGGCCCAGAGTTGGAGATATAGGCCTGGAAGTGGAGTTATGGGCCTAGAG
ATGGAGTGATGGGCCTAGAAGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGGTTGAGATATGGGCCTGCAGT
AGAGATATGGGCTTGTAGTGGAGACATGGGCCTGGAGATGGAGATATGGGCCTGGAGATGGAGATATGGGCCTGCAGTAG
AGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGATCTGGAGGTGGAGATACGGGCCTGCAGTAGAGA
TATGGGCCTGGAGTGGAGATATGGGCCAGGAGTGGAGTTATGGGCCTAGAGGTGGATATCTGGGCCTGGAGTGGAGATAT
GGGCCTAGGAAGGAGATATGGGCCTGGGTGTGGAGATATGGGACTGGAGAGGTGATATGGGCCTGGAGTGGAGATATGGG
CTTAGGGTGGAGATCTGGGCCTGGGGCAGAGATATGGGACTGGATTGGAGATATGGGCCTAGGGTGGAAATATCAGCCTG
GAGTGGAGATATGGGCTTGTGGTGGGGATCTGGGCCTGGAAACTGGGTCTCTGCACAGCCGACAGCCCTGTTCTTGGGTG
CAGGTAGGCACTGAGGGTGAGTTTAACTTCAGCCCAGGAAGGGCCTGGCTGCCAAGACTCACAGCCCAGTGGGGGCAGCA
AGGGAGTCCTGGTTTGCCTGCAGATGGATGGTCCATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGG
CCACATGAGGGTGAGTCCTTCTCCAAACCTTCGGTTGTCATCTCCCCACATAAGAGGATTTTCCTGAAACAGGAGGGAAG
TCCTGTCAGGGAGTCTCTCATAAACTGGGAAGAGAGGACCCTGGGGTGCTCGGCCCACATTTCTGACCTTGCCTCCCTGG
CCTCTCAACCCCTTGGCAGAGTCAAGTTCTGTGGGGACCAGGGTTAGACTGGGGTGCTCAAAGCTGGGGTGTGTGGTGGG
GAAGTGGTAGGAACAGCAGATCCTCTGAGGACAAAGGTGTTACTCACACACTTCAGCGTTTCCATGATGGTAGGGGCTGC
AGTGTGGCTGCTGTCATTCTACCAGAAGAGGTGGGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGATGGGGGC
TCAGTTGTTTATTTTCGTTCAGGCATCCGCTGATATCCACTCACAAAGGACATGCCCTCCACCTCATGTCTACCCTGTGT
TGTTTTATGTGAGTAATCTTACAGTATTAAAATCTAGTAGGAGTCTCTTTACTCAGCACTTGCTCAAAGTTCTCAGCTGA
GGCTTTTGTTGTAGGGAGACACCATGTCTTTGCGGGATGGGTCCTTCCTTCAGCCCTGGGCACCAAGGTGTGATAGTAGC
CATAGAAACGTGGAAAGCGAGGAGAATCTTCTGAGCACAGGGAGGGAGGGGCAGTTCCACATCCTCCTCTCTAAGGCGGC
GCCTCCTTCTCCCCAAGGTGGTCAGGACAAGCCCTTGCTGTCTGCCTGGCCCAGCCTTGTGGTGCCTCTAGGACATGTCA
TTCTTCGGTGTCACTCTTATCTTGGGTTTAACAACTTCAGTCTGTACAAGGAAGGTGGGGTGCCTGTCCCTGAGCTCTAC
AACAGAATATTCTGGAACAGCCTTTTCATGGGCCCTGTGACCCCCGCACAACAGGGACATACAGATGTCGGGGTTCACAC
ACACACTCCCCCAGTGGGTGGTCAGCACCCAGCAACCCCCTGGTGATCGTGGTCATAGGTCAGAGGGCTCCTGTCTTGGA
TTCTCCTTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGCATGTCCTTGAGGGTCCCATCACGCAGGCCCTGACTGT
ATTTGTGGTAAAGGGGGATTGAATACAGGGAAATGGGTGCTGTGGTGGGAAGAATAATTGTCCCCAGTGATGACTACATT
CTAATCCCTGGAGTCTGTGACTATGTATGTTATAGGGGAAGGGACTGAAGGGGAAGATGGAGCTCATGGGGAGACAGCCT
GGACTGTCCCACTGGGCTCAGTGTAATCACAAGGGTGCACATGAAAGGAGGAGGAAGAGGGGAGTGGGGATTAGAGCAGT
CCAGTGGAAGTCTTCACCAGCTTTGAAGGTGGAGGAAGGCCAAGAGCCATGAATGCAGGTGGCCTATAGAGGCTGGAAAA
GTCAAGGAACTGATTCTCCAGAGTCTCCAGAGGAAACGAAGCCCTGCAGATGCCTTGATTTTAGCCCAGGAAAAATAGGG
TCCAATTTCTGTCTCCAGTACTGGAAGGTGTCAGTGTGGTCTCTCCTGCTTCCATGCTTCTGATAATTTTGTACAGCAGC
AACAGGAAACCAACACTGGAACCCAGGTCAAGGACAAGTTAAGAAACAACCCAAGGAAAGCCAGGCATGGTGGCAGGCGC
ATGTAATCCTAGCGACTCAGGAGGCTGAGGGCAGGAGAATCACTTGAACCCAGGAAACAGAGGTTGCAGTGAGCCTAGAC
CACACCACTTCACTCCAGCCTGGGTGAAGGAGTGAGACTCTGTCTCCAAAATTAATTAATTAATTAAAGAAACCAAACAA
GGAGAAGGTTGGCTACCCTGAGATCAGCAAGGGTGGGATGATGATGCCACCACCAGGCTCCATCCACATAGGGAGGGGTT
GATACTCCTCCAACCAGCACCAGGAGCCAGCCTATGGAAGCTGGCACCATGGAGAAGGCACAGGCATGGCAAGAGTGGCT
CCCAGTCCCGACCAGGAACAGGGTGTGTGGACACTGGTGCCTGCCTTATTCATCAGTTCATACCTTCTGCCAAGGATTGC
AATTCATCCAAAAGAGATTGAACAAGGCTGATAAGAGCCTGGATGTGCAGCCTATCCTGGTTCCTCTTTCACCCCCACAT
AAACAGCAGGAAAGACGTTAGTGTGAAATAGATACAACACCCCAAGAGATGAGGCTAAGCCCAGTGGGAAGGGAATCAGA
GGCTACTAGAGACAGAGGGACAGAGAAGAGGGAGGGAGACAGATGGAAGGACCTGCACCAGGAGTTATGGGCACAGAAAA
GAACATGAAGACACAGAGAGGAAGGAGAGAGACAGACACCAGCAAGGGGAAGCCTCACTCATTCTAGGTGCCATGGATGG
GATGATAAAGAGAGACACCTTCTAAACTCACAACCTCTCTTCTTAGGAGTCCACAGAAAACCTTCCCTCCTGGCCCACCC
AGGTCCCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCAGGTTTGAGCACTTCCTTCTGCACA
GAGAGGGGAAGTATAAGGACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGT
CCCATGATGCAAGACCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTCCCCCTATCAGTTGTCAGCTCCCAG
TGACCCTCTGGACATCGTCATCACAGGTGAGAGTGTCCGGACATTCTCATTGTCATTGGGCTGCAGAGTGAATGATCCAC
GACTTGGAACCCCCAGGTAGTTGTAAGGAAGATGAGCTTGGTATTCTTATGGAGAGAGACTGACTTGCTGAGGTTTGTAC
CAACAGAGACAGAGAAACAGGAGACACAAGTACAGACCAGGTGTCATAACGGAGGACAGACACAGGGGCCATACAGGGAG
TTAGAAAAGACAGAAAGAGTTAAAGGAGACAGACAGACAGACATGTCCCAGAGAGAGGTGTCCCTCCATGCTGACTTTGC
TCACAGACCTGGCACAGGATAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTGTTCTCTACCAGGAGAACCCAAGGACA
CCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCACCTACAGGCCATGTTTATTCTGACACCTCTG
CCTTCCATGTAATGGAGAGTAACCGTCCCAGGATATCATGGCCCCAGAACACCAACCCCTGTATGCTGTGTGAACTTGTG
GTCTCCAGACTGGATTCTGAGGCTCACATTCCAAATAACCCCACATATGAAAGGATCACTGAGAGGCACAGAGAGAAATC
AGGAACACCAAAAAGCAAAGACATAAACACACAGAGAATGGGCCAGAGGAAGGAGATTGAGAGACTCACTGACACATAAA
GAGAGAGAAAAGAGGGCAGAGGAGTGGTGAGAATGATGGAAGGGAGCAGAGAAAAGCACTAAAATTAGAGTCCTGAGGGA
GAGGCACAAGGACATAGAAAGATGGAGATGTGGGGATGAACTGCAGAGATTCCAAAGAGAACTAGAGAGACCGAGAGGCA
GAGCAAGACAGATGATAGATGGATAGATATAGATAGATGATAAATAGGTAGATGATAGATAATAGGTTAAAGATACATAG
ATGATGATTGATTGATTCATTAATAGATAATACATAGAGATGATGATGATGAAGACAGATAGATAATACGTACAGATAGA
GAGGCAGACAGAAATCATAGAGAGAGAGATGATACATACATATAAATAACAGATGATTGATGGATAGATAGACAACTGAT
AGATACATAGATGATATATAGATATAGATGACAGGTAGAGAATTTGTAGATAGGCACCGAATAGATAAATAGATAGATCG
ACAGATAATAGATAGAAATATGCAGAAAGTTATGAACAGGACACAACGTGAGAAACTTAGAATTTAAAAAAGTAACATCA
AGTCAACCAATCCAAGGAGAGTCAGAGAGAATAAAAGAATCCAAAAAGGGAAAACATATCTAGAGGTGGGGAAGCGAGGT
CAGAGACCTAGAGAGACAGAGAAGGTGGAAGGAGGAAATAGACATGAAGAGAGATGGGGTGGAGGGTGAGAGAGAGAGAG
AGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTGAAGGGAGCTGTGACAAGGAAGATCCTCCCTGA
GGAAAATGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTTTGGCAGGA
GAGAGCGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTATCCAGGGAGGGGGAGGCCCATGAACG
TAGGTTCTCTGCAGGGCCCAAGGTCAACGGAACATTCCAGGCCGACTTTCCTCTGGGCCCTGCCACCCACGGAGGAACCT
ACAGATGCTTCGGCTCTTTCCGTGACTCTCCCTATGAGTGGTCAAACTCGAGTGACCCACTGCTTGTTTCTGTCACAGGT
GAGGAAACCCCATATCTGTCTCATGTCCTATGATCCTAGAGCCTTAGCTGAGGAGCTTCCTGCTGATGATGGAGAGAAGC
ATGGACAGATGCAGAGAGAAGACGAAGCTTGGGTGTGAGGGAGGGATCAGGGCACAGGATGGCAGACAGGGCACCTCCAA
ACCCTCCTACACGGCCTGCATGAAGGCCCGCGGCCAGGGCTCCAGGCACACAGGCAGATGGAGAAAACGGTCAGGAGAGA
CCCAGAGGAGAGAGACTGGGCTCAGTTTGGGAAGATCAGAGGTTCCCTCAGCCCCTCAACATTATCCATTTCCCAGAAGC
CCATCCTGGCCTCTCACCCACACAGGGATGTCATCACCAGCAACCCCTACACCCTTTACTTTTGTTTGAAGAAATATTTA
TTGAGGATAAATATACCTATATAGCTTACCACCTTTAACATTTTTTTTTTTTTTGAGGCAGAGTCTAGCTCTGTCCCCTA
TGCTGGAGTGCAGTGGCACAATCTCAGCTCACTGCAATTTCCGCCTCCTGGGTTCAAGCGATTCTCTTGCCTCAGCCACC
TGAGTAGCTGGTGCTACAGGCGCGCACCACCACGCCAGGCTACTTTTTGTATTTTTAGTAGAGAGGTGGTTTCACCATGT
TGGTCGAGCTGGTCTCCAACTCCTGACCACGTGATCCACCCGCATGTGCCTCCCAAAGTGCTGGGATTACAGGCATGAGC
CACCACGCCCAGCCACATTTACCATTTTTAAGTGTAAAGTCTAGTGGTCATAAATACATTTATATATATATATTTTTTTT
TTTTTTTTTTACCCTCCACCCTTTTCTTCCTGGCCTCTGGAAGCCATCATTCTACTCTCTACCTTCATGAGATCCACCTT
TTAGCTCTGTATATGGGTGAGAAATGGGAATCTTTGTAATGACTTCCAGTTCCATCCATGTGGCTGCAAATATCAGGATG
TTATTCTTTCTATGGATGAGTAGTCTCCACTGTGCGTATGTACTACATTCTCTCTATCCATTCATCCACTGATGGGCAGG
TAGGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGCACCAATCATACGAGTGCAGATATCACTTCGATATATTGAT
TTACTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGATACTATGAAAGTTCTCTTTTTAGTTTTTCGTTTGTTGT
TTTGTTTTTGTTTTTGAGACAGTTTCCCTCTGTGCCCAGGCTGGAGTACAAGTGATGTCATCTTGGCTCATTGCAACCTC
TGCCTCCTGGGTTCAAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCTGGGATTACAGGTGCACGCCACCATGCCTGGCT
ACTTTTTGTTTTTTTTAGTATAGATGGGGTTTCCCCATGTTGGCTGGGCTGCTCTCAAACTCATGACCTCAACTGAGATG
CCCGCCTCAGTCTCCCAAAGTGCCGGGATTACAGGCCTGATCCACCACACCCAACCTCTTTTTAGTTCTTTAAAGGACTT
CCATACTTTTCTCCGTAATCGCTGTACTAATTTACACTCCTCCCAACAGGGTACCAGGGTTCTCCTTTCTCTACCACCTT
GCCAGCATTTCTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTTATTTCATTTTATTTTGAGATGGAGTTTTGCTCT
TCTCACCCAGGCAGGAGTGCAGTGGCGCTATCTCGGCTCACCACAACCTCCACCTCCCAGGTTCAAGCGATTCTCCTGCC
TCAGCCTCCCGAGTAGCTGGAATTACAGGCACACTCCACCACGCCCGACTAATTTTTGTATTTTTAGTAGAGACAGTGTT
TCTCTATGTGGGTCAGACTGGTCTCAAACTCCTGACCTTATGAGATTCACCCACCTCAGGCTCTCAAAGTTCTAGGATGA
CAGACGTGAGCCACCACGCCCGGCCTAAAAGCCATTTTAATGGGGTGAGATGAAAACTCACTTTGATTTTAATTTGCGTT
TCTCTGATGATGAGTGATACTGAGCACTTTTTAGTATGTGGGGAAATTTCATGTCTTCTGCTCCTTTTTCAATTAAATCA
TTTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCTAGTTATTAATCCCATCTCAGATGCATAGTTTGCACATATTTGC
TCCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCAGTGCAGAAGTTGCTTAGTTTGAGGTAATCCCAA
TGGTCTATTTTTGCTTCGATTACTTGTGTTTTCAAGGTTTAAAACAAAATGTCTTTCTTCAGACAAATGTCCTGGAGCAT
TTCCCCAATATTTTGTTCTACGTGTTTCATAGGTTCAGGCCTTAGACTCACATCTTTAATCCATTTTCATTTGATTTTTG
TGTATGGTGACAGGTAGAGGTGCAGTTTCATTCCTCTGCATGTCGATGTCCAGGTTTCCCTGCACTGTTTATTGAAAAGA
CTGTCCTTTCCTGATTGTGAGTTCTTGGCACCTTTGTCAAAGTCCATTGGATGGGCTGGGCTTGGTGGCTGACACCTGCA
ATTTCAGCACTTTGGGAGGCCGAGGCGGGTGGATTACCTGAGGCCAGGAGTTCAAGATCAGTCTGGACGACGTGATGAAA
CATCGTCTCCACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCACCTGTAATACCACTACTCAGGAGTTTGAGGC
AAGAGAATGATTGAACCCAGGAGGCTGAGGTTGCAGTGAACTGAGATTGCACCTCTGCACTCCAGCCTGAGTGACAGAGC
AAGACTCCATCTCAAAAGAAAAAATAAAAAACCATTGGATGTAAATGCATGGAATATATCTGTGTTATTCATTCTGCTCC
GTTGTTCTATGTCCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTACTACAGCTCTGTAACATATTTTGAGATCAGGT
AGTGTGATGCTCCTGTTTTCTCTTTATACCTTGAAGTCTCAAGACAGTGGGCGTCACATAAAAAAATTATGGAAAAAAGG
ATCCCAGGACTCCCAGGGCCCAATATTAGATAACAGAGTGTTGGCCATGAACCATCCTCAAAGATTTCCACTGAGTAGAG
GACAGACACCCTCATTTCCTCACCTCTCTCCTGTCTCATGTTCTAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGA
ACCAAGCTCCAAAACCGGTGAGTACAGAACCCTCTTATATCCGCTTTTGGAAACCTGGGGAGGTGGAAACCTTGGATTCA
GGCGTTGACTCAGCATCTCACAGCTCTGACATTGTACCCCTGTCTTCCACCATCTCCGAACTCCAGATACTCCTACAGCG
AAAGGGATCTGGGTCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTCATTTTATGGAGCTGAGACTTCCTACAAGCTA
GAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAATGTTTGTTCTGCCTGCATTCCTAACTGGAGGATAAA
TTCCTGGAGACTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGCGAGGTGTTTTAGAGAAGTTCCACTTGCCAAGG
AATGAGCTCCTATAGGTCATGAAGCAACCCTGGCTGACTCAGCAGAGAAAGAGCCTTGCTGTAACAGAGAACAGAGCTCA
TGCACGCACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTCAGGCTGTGCACTGTGGAAGCTTTTCCTATTG
TTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTTTTTAATTATCTTACAGTGCTGTAGCTCAAAG
TATGAAGTGCATCTCACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCTTCCCTCTGAGGATTCCAGGCAAGAATCTGC
TTCTCACTTTTCTCAGCTTCTAGAGGCTCCCACATTCCTTCGCTCCTGGTCCCCTTCCTCCTTCCTCAAAGCCCACAAAG
ACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACCTCTTTCTCTGAATGCTGCTCTCCCTTCTT
CCTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCATCATAATCTCCCGGAAATCATTCAGG
ATACCCTTGTTTTAAGTTCAGCTGATTAGCAACCATAATTCCATCTGCAATCTTCATTCCTCCTTTCCATGTAAAATAAG
ATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGCATTCTCCTGCCTTCCACAAACAGTGAACA
AGATGCATTTGGCCTCTGCTCTTTGGACACTGATATTGCAGATGGTTAAATGGGAGGGCAGAAAATGAATGCACAAGTGG
ACCAATAAATGAATGATCCATTGGGAAGCATCTGTGTATGAAATCTATTTGTTTGTTTCTTCATTTGTTTATTGAGACAG
AGTCTCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACCATCTTGGCTCACTGCAACCTGCACCTTCTGGATCCAAGTGA
TTCTCCTGCGTCAGCCTCTCAAGTAGCTGGGATTACAGGCAACTGCCACCATGCCCGGCTAATTCTTTTTGTATATTTTT
TGTAGAGGATGTTTCACCATCTTCGCCAAGCTTCTCTGAAACTCCCAACCTCAAGTGATCCGACCGTCTCAGCATCCTAA
AGTACTGGGATAACTGGCGTGAGCCACTGTGCCCAGCCAGAATTTAAAATAAATAATACATAATGCTGAGTGTATGATTT
TGGGTGACAGAGAAGATCTCACTAATCAGATATTTGTGACATTAATGAAAAACACGGATTGAACCCCTGAAAGATTGGCG
GAAGGATTTTCCACACACAGCTGTCAGCCGTGAAGGCAGAAAGCTGAAAACAATCTGATGTGGAAGGAAGAGGCTCTGCC
TCAAATGCTGGGAATGAGGTGGGGAGAATGACAAGACGACTGTGGAGAGACGGAGAGCACACTGGGTACACAGGAAACTA
AGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACCTCGGGGTAGCCAGGAATCCCTACATGATTAA
TAGTGACTGACATGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCTAGGAGACTGTGGAAAAGGCAATTCCCGCCCC
ACTGGTGAAATGTGGTGCTGATTTAGACCCTAACTGGGTGAAGCAGATGGATATAAGCTATGCTTGTGAGGTGGAATCAT
TGGCTGGAAAGGCTTGCTGGGTATGATTTTCCTAGTTGTCTAATCCTCGCTTAATTTCTTTCTGAGCTTTATTCCTACTA
CACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGGTGGTGGAAATGAAGGGACCTATTATAGCATAATAT
ACAAGTCTGTGAACGGTGGCTCACGCCTGTAACCCAGCACTGCAGGAGGCCAAGGCGGGTGGATCACATGAAGTCAGCAG
TTCGAGACCAGCCTGGCCAACATGGTGAAACCCTGTCTCTAGGAAAAACACAAAAATTAGCCGAGCATGGTGGTGCATCC
CTGTAATCCCAGCTCCTACTCTGGAGGATGAAGCAGGAGAATGACTTCAACCCAGGAGGTGGAGGTTGCAGTGAGTGGAG
ATTGCATCACTGCACTCCAGCCTGGGTGACACAAGGAGACTCCGTCTCAAAAAATAAAAATAAGAAATGCATAAATATAA
ATATAATATAACACATGCAAATGAGAAAGGGACCTGAATTCCAATCATGATTTTTCTATTTCTCTATAATTACTTCTTTG
ATCCTTTATCTTATCCATTAGGCAATGAGCCTAAAACCTCTTCCCTATTTGGCTTTCTGTGAGCATGAGATCATATAGAA
AATGTGAAAGCCCGCTGAATCCTCCAGCACAGATCCTGGAATACACAAAGTGCTCTGTTCATCACAAGAAAACATGCCCT
CTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCATCTGTGGAGATTCAGATAGGCCATGGGGAGGTAAATTCTAAT
ACTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATTAGCGTCAGCAGTAGCTCCTGCTCCCCTTTCCTACTAATTCAC
AGGAGGACAGGTGGTATTGAAGCAATAGATGGCCGAGGGGGTGGTCCTTCCCCCAGCCTCTCGGGTAGAACAGCAACCTA
ACATGTGTCTCCTGAGATCACAAAGAGTAGCACGTTTCACATGGGCTTCAACACTGTTTCCTGGCCATTTGACATAAGAG
AATTCTACTTCGCTTTTTTTATCTTGATTTCACTTTTGTTTCCTTTTCTTGGAGAATGCAAGTTGTTTGACTCAAGAATG
CCGTGGATGTAGAAATCCTAAAGCACAGTCGCTGTGTATCAATCCCAGTGCAGTCTTCCCAGAGAAGACTCTAAACACCT
CCTGGACTGCACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAATACATTA
CACAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTACATTTCAATGTGAGCCAGTCCCTCAAGG
CTCAGAAAAGCTGCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAGCTGCGGGAAGCCAGAAAGCAGCCCAGCCTGG
GTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGCCTTCCTCCAGGAAGAACAGGAAGACAGC
CCAGGCTGTTCTGAGACATTCCTCCTGATCTCAGGTCGTTGCTGTCTTAGTTTTTTTTTTTGTTGCTCTGAAGGAACACT
TGAGCCTCGGTAACTTCTAAAGAAAAGAGATCGGTTTGCCTCACAGTTCTGCAGGCTGTACTGGAAGCATGGCACCAGAA
TCTATTTCTCGTGATGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCACAGAGA
TCACACGGCAAGAGAGAGAGTAAGGGGGAGAGGGAGCAATGGAGCTTCCAAGCTCTTTTTAACAACCAGCTGTCCAGGAA
CTAACAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGATCTGTTCATGATGGATCCACCTCCATGACCCA
AACACCTCTGAAGAGGCCCAACCTCCCACAATGGGGGTGAAATTTCAATGTGAGGTTTGAAGGGGTCAAACATCTCAACT
AAAGTAGTTGTATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAATTGAGAAAGCAGGGGAAAGCTAGGTCTCCCG
CCATTTGGGTGCTTGTCCTAAAGAGACGTTGTATGTGGTTACCTGCCAATCAAGAAATGCGAGACAATTCATAAAGAGGA
ACTGCTATGATTAGCTTCTTATTGGTGTCTCCTCTTCTTCCAGGTAACCCCAGACACCTGCATGTTCTGATTGGGACCTC
AGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCTCCAACAAAAAAAGTAAGTCTCACG
AAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCACTCAGGTGTGTGTTCCTCACCAGCAGGATG
GTCCCTGGCCCAAGACAGGAGCCACAGAGGCAGGACTTTCTAGAGAGAGCACCAGATTCCCTTCCCCTGCCTTCAGCTCA
CAGACCGTTGCCTGATTCTGAACTGTACCCTCACGTCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGACAGGCA
GAAAGTGGGAGATAGAATCAATGGGATGGGAACTCAGAGCTATTCATGGGATGGGTCCTTGAACTCAGAGAGATAGAATG
TCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGGCACCTATGGCCTCCCCCTGTTTGTTGGTATCTGCTTATGAAATGA
GGACCCAGAAGTGCCCTCCGAGCTCTTTTGTTGACTTCCGTCTTCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCAG
GGAACAGAACAGTGAACAGCGAGGTAGGTGCTCCTCGGCCCAGCCTCGTGGCTAGTCTTATTCCCAAAGAGTCCTGAAAA
ATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGATTCTGATGAACAAGACCATCAGGAGGTGTCATACGCA
TAATTGGATCACTGTGTTTTCACACAGAGAGAAATCACTCGCCCTTCTGAGAGGCCCAAGACACCCCCAACAGATACCAG
CATGTACATAGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTTCTGTCCACGAGCACCACAGTCAGGCCTTGAGG
GGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATGTACCAGCAGCTGGAATCTGAAGGCA
TCAGTCTTCATCTTAGGGCATCGCTCTTCCTCACACCACGAATCTGAACATGCCTCTCTCTTGCTTACAAATGTCTAAGG
TCCCCACTGCCTGCTGGAGAGAAAACACACTCCTTTGCTTAGCCCACAATTCTCCATTTCACTTGACCCCTGCCCACCTC
TCCAACCTAACTAGCTTACTTCCTAGTCTACCTGAGGCTGCAATCACACTGAGGAACTCACAATTCCAAACATACAAGAG
GCTCCCTCTTAACACAGCACTTAGACACGTGCTGTTCCACCTCCCTTCAGACTATCTTTCAGCCTTCTGCCAGCAGTAAA
ACTTATAAATTTTTTAAATAATTTCAATGTAGTTTTCCCGCCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR