Allele Report for 2DS2*0010106


2DS2*0010106
Previous Designations & Local Names: FH06_BA1
IPD Acc No: KIR00447
Assigned: 28-AUG-2009 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182341  
Cells Sequence Derived From: FH06  
Known Ethnic Origin Of Source: Hispanic
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (304 aa)
MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGV
SKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHL
SREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA
Nucleotide Sequence Data (915 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACATGAGGGAGTCCACAG
AAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCA
GGTTTGAGCACTTCCTTCTGCACAGAGAGGGGAAGTATAAGGACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTC
TCCAAGGCCAACTTCTCCATCGGTCCCATGATGCAAGACCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTC
CCCCTATCAGTTGTCAGCTCCCAGTGACCCTCTGGACATCGTCATCACAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTTTGGCAGGAGAGAGCGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTA
TCCAGGGAGGGGGAGGCCCATGAACGTAGGTTCTCTGCAGGGCCCAAGGTCAACGGAACATTCCAGGCCGACTTTCCTCT
GGGCCCTGCCACCCACGGAGGAACCTACAGATGCTTCGGCTCTTTCCGTGACTCTCCCTATGAGTGGTCAAACTCGAGTG
ACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTAAC
CCCAGACACCTGCATGTTCTGATTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCG
CTGGTGCTCCAACAAAAAAAATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGATTCTG
ATGAACAAGACCATCAGGAGGTGTCATACGCATAA
Genomic Sequence Data (14548 bps)
GTATGAGAGGTTGGATCTGAGACGTCTTTTGAGTCTGGTCGTAGTGAAGGACGCAAGGTGTCAATTCTAGTGAGAACAAT
TTCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCC
TCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGC
GCGGCCGCCTGTCTGCACAGACAGCACCATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAA
TCGAGGGAGGGAGTGCGGGGATGGAGATCGGGGCCCAGAGTTGGAGATATAGGCCTGGAAGTGGAGTTATGGGCCTAGAG
ATGGAGTGATGGGCCTAGAAGTGGAGATCTGGGCCTGGAGTGGAGATATGGGCCTGGAGGTTGAGATATGGGCCTGCAGT
AGAGATATGGGCTTGTAGTGGAGACATGGGCCTGGAGATGGAGATATGGGCCTGGAGATGGAGATATGGGCCTGCAGTAG
AGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGATCTGGAGGTGGAGATACGGGCCTGCAGTAGAGA
TATGGGCCTGGAGTGGAGATATGGGCCAGGAGTGGAGTTATGGGCCTAGAGGTGGATATCTGGGCCTGGAGTGGAGATAT
GGGCCTAGGAAGGAGATATGGGCCTGGGTGTGGAGATATGGGACTGGAGAGGTGATATGGGCCTGGAGTGGAGATATGGG
CTTAGGGTGGAGATCTGGGCCTGGGGCAGAGATATGGGACTGGATTGGAGATATGGGCCTAGGGTGGAAATATCAGCCTG
GAGTGGAGATATGGGCTTGTGGTGGGGATCTGGGCCTGGAAACTGGGTCTCTGCACAGCCGACAGCCCTGTTCTTGGGTG
CAGGTAGGCACTGAGGGTGAGTTTAACTTCAGCCCAGGAAGGGCCTGGCTGCCAAGACTCACAGCCCAGTGGGGGCAGCA
AGGGAGTCCTGGTTTGCCTGCAGATGGATGGTCCATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGG
CCACATGAGGGTGAGTCCTTCTCCAAACCTTCGGTTGTCATCTCCCCACATAAGAGGATTTTCCTGAAACAGGAGGGAAG
TCCTGTCAGGGAGTCTCTCATAAACTGGGAAGAGAGGACCCTGGGGTGCTCGGCCCACATTTCTGACCTTGCCTCCCTGG
CCTCTCAACCCCTTGGCAGAGTCAAGTTCTGTGGGGACCAGGGTTAGACTGGGGTGCTCAAAGCTGGGGTGTGTGGTGGG
GAAGTGGTAGGAACAGCAGATCCTCTGAGGACAAAGGTGTTACTCACACACTTCAGCGTTTCCATGATGGTAGGGGCTGC
AGTGTGGCTGCTGTCATTCTACCAGAAGAGGTGGGAAACCACAGCCATGGCCCTGACATTCCAAATCCTCTGATGGGGGC
TCAGTTGTTTATTTTCGTTCAGGCATCCGCTGATATCCACTCACAAAGGACATGCCCTCCACCTCATGTCTACCCTGTGT
TGTTTTATGTGAGTAATCTTACAGTATTAAAATCTAGTAGGAGTCTCTTTACTCAGCACTTGCTCAAAGTTCTCAGCTGA
GGCTTTTGTTGTAGGGAGACACCATGTCTTTGCGGGATGGGTCCTTCCTTCAGCCCTGGGCACCAAGGTGTGATAGTAGC
CATAGAAACGTGGAAAGCGAGGAGAATCTTCTGAGCACAGGGAGGGAGGGGCAGTTCCACATCCTCCTCTCTAAGGCGGC
GCCTCCTTCTCCCCAAGGTGGTCAGGACAAGCCCTTGCTGTCTGCCTGGCCCAGCCTTGTGGTGCCTCTAGGACATGTCA
TTCTTCGGTGTCACTCTTATCTTGGGTTTAACAACTTCAGTCTGTACAAGGAAGGTGGGGTGCCTGTCCCTGAGCTCTAC
AACAGAATATTCTGGAACAGCCTTTTCATGGGCCCTGTGACCCCCGCACAACAGGGACATACAGATGTCGGGGTTCACAC
ACACACTCCCCCAGTGGGTGGTCAGCACCCAGCAACCCCCTGGTGATCGTGGTCATAGGTCAGAGGGCTCCTGTCTTGGA
TTCTCCTTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGCATGTCCTTGAGGGTCCCATCACGCAGGCCCTGACTGT
ATTTGTGGTAAAGGGGGATTGAATACAGGGAAATGGGTGCTGTGGTGGGAAGAATAATTGTCCCCAGTGATGACTACATT
CTAATCCCTGGAGTCTGTGACTATGTATGTTATAGGGGAAGGGACTGAAGGGGAAGATGGAGCTCATGGGGAGACAGCCT
GGACTGTCCCACTGGGCTCAGTGTAATCACAAGGGTGCACATGAAAGGAGGAGGAAGAGGGGAGTGGGGATTAGAGCAGT
CCAGTGGAAGTCTTCACCAGCTTTGAAGGTGGAGGAAGGCCAAGAGCCATGAATGCAGGTGGCCTATAGAGGCTGGAAAA
GTCAAGGAACTGATTCTCCAGAGTCTCCAGAGGAAACGAAGCCCTGCAGATGCCTTGATTTTAGCCCAGGAAAAATAGGG
TCCAATTTCTGTCTCCAGTACTGGAAGGTGTCAGTGTGGTCTCTCCTGCTTCCATGCTTCTGATAATTTTGTACAGCAGC
AACAGGAAACCAACACTGGAACCCAGGTCAAGGACAAGTTAAGAAACAACCCAAGGAAAGCCAGGCATGGTGGCAGGCGC
ATGTAATCCTAGCGACTCAGGAGGCTGAGGGCAGGAGAATCACTTGAACCCAGGAAACAGAGGTTGCAGTGAGCCTAGAC
CACACCACTTCACTCCAGCCTGGGTGAAGGAGTGAGACTCTGTCTCCAAAATTAATTAATTAATTAAAGAAACCAAACAA
GGAGAAGGTTGGCTACCCTGAGATCAGCAAGGGTGGGATGATGATGCCACCACCAGGCTCCATCCACATAGGGAGGGGTT
GATACTCCTCCAACCAGCACCAGGAGCCAGCCTATGGAAGCTGGCACCATGGAGAAGGCACAGGCATGGCAAGAGTGGCT
CCCAGTCCCGACCAGGAACAGGGTGTGTGGACACTGGTGCCTGCCTTATTCATCAGTTCATACCTTCTGCCAAGGATTGC
AATTCATCCAAAAGAGATTGAACAAGGCTGATAAGAGCCTGGATGTGCAGCCTATCCTGGTTCCTCTTTCACCCCCACAT
AAACAGCAGGAAAGACGTTAGTGTGAAATAGATACAACACCCCAAGAGATGAGGCTAAGCCCAGTGGGAAGGGAATCAGA
GGCTACTAGAGACAGAGGGACAGAGAAGAGGGAGGGAGACAGATGGAAGGACCTGCACCAGGAGTTATGGGCACAGAAAA
GAACATGAAGACACAGAGAGGAAGGAGAGAGACAGACACCAGCAAGGGGAAGCCTCACTCATTCTAGGTGCCATGGATGG
GATGATAAAGAGAGACACCTTCTAAACTCACAACCTCTCTTCTTAGGAGTCCACAGAAAACCTTCCCTCCTGGCCCACCC
AGGTCCCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCAGGTTTGAGCACTTCCTTCTGCACA
GAGAGGGGAAGTATAAGGACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTCTCCAAGGCCAACTTCTCCATCGGT
CCCATGATGCAAGACCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTCCCCCTATCAGTTGTCAGCTCCCAG
TGACCCTCTGGACATCGTCATCACAGGTGAGAGTGTCCGGACATTCTCATTGTCATTGGGCTGCAGAGTGAATGATCCAC
GACTTGGAACCCCCAGGTAGTTGTAAGGAAGATGAGCTTGGTATTCTTATGGAGAGAGACTGACTTGCTGAGGTTTGTAC
CAACAGAGACAGAGAAACAGGAGACACAAGTACAGACCAGGTGTCATAACGGAGGACAGACACAGGGGCCATACAGGGAG
TTAGAAAAGACAGAAAGAGTTAAAGGAGACAGACAGACAGACATGTCCCAGAGAGAGGTGTCCCTCCATGCTGACTTTGC
TCACAGACCTGGCACAGGATAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTGTTCTCTACCAGGAGAACCCAAGGACA
CCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCACCTACAGGCCATGTTTATTCTGACACCTCTG
CCTTCCATGTAATGGAGAGTAACCGTCCCAGGATATCATGGCCCCAGAACACCAACCCCTGTATGCTGTGTGAACTTGTG
GTCTCCAGACTGGATTCTGAGGCTCACATTCCAAATAACCCCACATATGAAAGGATCACTGAGAGGCACAGAGAGAAATC
AGGAACACCAAAAAGCAAAGACATAAACACACAGAGAATGGGCCAGAGGAAGGAGATTGAGAGACTCACTGACACATAAA
GAGAGAGAAAAGAGGGCAGAGGAGTGGTGAGAATGATGGAAGGGAGCAGAGAAAAGCACTAAAATTAGAGTCCTGAGGGA
GAGGCACAAGGACATAGAAAGATGGAGATGTGGGGATGAACTGCAGAGATTCCAAAGAGAACTAGAGAGACCGAGAGGCA
GAGCAAGACAGATGATAGATGGATAGATATAGATAGATGATAAATAGGTAGATGATAGATAATAGGTTAAAGATACATAG
ATGATGATTGATTGATTCATTAATAGATAATACATAGAGATGATGATGATGAAGACAGATAGATAATACGTACAGATAGA
GAGGCAGACAGAAATCATAGAGAGAGAGATGATACATACATATAAATAACAGATGATTGATGGATAGATAGACAACTGAT
AGATACATAGATGATATATAGATATAGATGACAGGTAGAGAATTTGTAGATAGGCACCGAATAGATAAATAGATAGATCG
ACAGATAATAGATAGAAATATGCAGAAAGTTATGAACAGGACACAACGTGAGAAACTTAGAATTTAAAAAAGTAACATCA
AGTCAACCAATCCAAGGAGAGTCAGAGAGAATAAAAGAATCCAAAAAGGGAAAACATATCTAGAGGTGGGGAAGCGAGGT
CAGAGACCTAGAGAGACAGAGAAGGTGGAAGGAGGAAATAGACATGAAGAGAGATGGGGTGGAGGGTGAGAGAGAGAGAG
AGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTGAAGGGAGCTGTGACAAGGAAGATCCTCCCCGA
GGAAAATGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCTCTCAGCCCAGCCGGGCCCCACGGTTTTGGCAGGA
GAGAGCGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTATCCAGGGAGGGGGAGGCCCATGAACG
TAGGTTCTCTGCAGGGCCCAAGGTCAACGGAACATTCCAGGCCGACTTTCCTCTGGGCCCTGCCACCCACGGAGGAACCT
ACAGATGCTTCGGCTCTTTCCGTGACTCTCCCTATGAGTGGTCAAACTCGAGTGACCCACTGCTTGTTTCTGTCACAGGT
GAGGAAACCCCATATCTGTCTCATGTCCTATGATCCTAGAGCCTTAGCTGAGGAGCTTCCTGCTGATGATGGAGAGAAGC
ATGGACAGATGCAGAGAGAAGACGAAGCTTGGGTGTGAGGGAGGGATCAGGGCACAGGATGGCAGACAGGGCACCTCCAA
ACCCTCCTACACGGCCTGCATGAAGGCCCGCGGCCAGGGCTCCAGGCACACAGGCAGATGGAGAAAACGGTCAGGAGAGA
CCCAGAGGAGAGAGACTGGGCTCAGTTTGGGAAGATCAGAGGTTCCCTCAGCCCCTCAACATTATCCATTTCCCAGAAGC
CCATCCTGGCCTCTCACCCACACAGGGATGTCATCACCAGCAACCCCTACACCCTTTACTTTTGTTTGAAGAAATATTTA
TTGAGGATAAATATACCTATATAGCTTACCACCTTTAACATTTTTTTTTTTTTTGAGGCAGAGTCTAGCTCTGTCCCCTA
TGCTGGAGTGCAGTGGCACAATCTCAGCTCACTGCAATTTCCGCCTCCTGGGTTCAAGCGATTCTCTTGCCTCAGCCACC
TGAGTAGCTGGTGCTACAGGCGCGCACCACCACGCCAGGCTACTTTTTGTATTTTTAGTAGAGAGGTGGTTTCACCATGT
TGGTCGAGCTGGTCTCCAACTCCTGACCACGTGATCCACCCGCATGTGCCTCCCAAAGTGCTGGGATTACAGGCATGAGC
CACCACGCCCAGCCACATTTACCATTTTTAAGTGTAAAGTCTAGTGGTCATAAATACATTTATATATATATATATTTTTT
TTTTTTTTTTTACCCTCCACCCTTTTCTTCCTGGCCTCTGGAAGCCATCATTCTACTCTCTACCTTCATGAGATCCACCT
TTTAGCTCTGTATATGGGTGAGAAATGGGAATCTTTGTAATGACTTCCAGTTCCATCCATGTGGCTGCAAATATCAGGAT
GTTATTCTTTCTATGGATGAGTAGTCTCCACTGTGCGTATGTACTACATTCTCTCTATCCATTCATCCACTGATGGGCAG
GTAGGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGCACCAATCATACGAGTGCAGATATCACTTCGATATATTGA
TTTACTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGATACTATGAAAGTTCTCTTTTTAGTTTTTCGTTTGTTG
TTTTGTTTTTGTTTTTGAGACAGTTTCCCTCTGTGCCCAGGCTGGAGTACAAGTGATGTCATCTTGGCTCATTGCAACCT
CTGCCTCCTGGGTTCAAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCTGGGATTACAGGTGCACGCCACCATGCCTGGC
TACTTTTTGTTTTTTTTAGTATAGATGGGGTTTCCCCATGTTGGCTGGGCTGCTCTCAAACTCATGACCTCAACTGAGAT
GCCCGCCTCAGTCTCCCAAAGTGCCGGGATTACAGGCCTGATCCACCACACCCAACCTCTTTTTAGTTCTTTAAAGGACT
TCCATACTTTTCTCCGTAATCGCTGTACTAATTTACACTCCTCCCAACAGGGTACCAGGGTTCTCCTTTCTCTACCACCT
TGCCAGCATTTCTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTTATTTCATTTTATTTTGAGATGGAGTTTTGCTC
TTCTCACCCAGGCAGGAGTGCAGTGGCGCTATCTCGGCTCACCACAACCTCCACCTCCCAGGTTCAAGCGATTCTCCTGC
CTCAGCCTCCCGAGTAGCTGGAATTACAGGCACACTCCACCACGCCCGACTAATTTTTGTATTTTTAGTAGAGACAGTGT
TTCTCTATGTGGGTCAGACTGGTCTCAAACTCCTGACCTTATGAGATTCACCCACCTCAGGCTCTCAAAGTTCTAGGATG
ACAGACGTGAGCCACCACGCCCGGCCTAAAAGCCATTTTAATGGGGTGAGATGAAAACTCACTTTGATTTTAATTTGCGT
TTCTCTGATGATGAGTGATACTGAGCACTTTTTAGTATGTGGGGAAATTTCATGTCTTCTGCTCCTTTTTCAATTAAATC
ATTTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCTAGTTATTAATCCCATCTCAGATGCATAGTTTGCACATATTTG
CTCCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCAGTGCAGAAGTTGCTTAGTTTGAGGTAATCCCA
ATGGTCTATTTTTGCTTCGATTACTTGTGTTTTCAAGGTTTAAAACAAAATGTCTTTCTTCAGACAAATGTCCTGGAGCA
TTTCCCCAATATTTTGTTCTACGTGTTTCATAGGTTCAGGCCTTAGACTCACATCTTTAATCCATTTTCATTTGATTTTT
GTGTATGGTGACAGGTAGAGGTGCAGTTTCATTCCTCTGCATGTCGATGTCCAGGTTTCCCTGCACTGTTTATTGAAAAG
ACTGTCCTTTCCTGATTGTGAGTTCTTGGCACCTTTGTCAAAGTCCATTGGATGGGCTGGGCTTGGTGGCTGACACCTGC
AATTTCAGCACTTTGGGAGGCCGAGGCGGGTGGATTACCTGAGGCCAGGAGTTCAAGATCAGTCTGGACGACGTGATGAA
ACATCGTCTCCACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCACCTGTAATACCACTACTCAGGAGTTTGAGG
CAAGAGAATGATTGAACCCAGGAGGCTGAGGTTGCAGTGAACTGAGATTGCACCTCTGCACTCCAGCCTGAGTGACAGAG
CAAGACTCCATCTCAAAAGAAAAAATAAAAAACCATTGGATGTAAATGCATGGAATATATCTGTGTTATTCATTCTGCTC
CGTTGTTCTATGTCCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTACTACAGCTCTGTAACATATTTTGAGATCAGG
TAGTGTGATGCTCCTGTTTTCTCTTTATACCTTGAAGTCTCAAGACAGTGGGCGTCACATAAAAAAATTATGGAAAAAAG
GATCCCAGGACTCCCAGGGCCCAATATTAGATAACAGAGTGTTGGCCATGAACCATCCTCAAAGATTTCCACTGAGTAGA
GGACAGACACCCTCATTTCCTCACCTCTCTCCTGTCTCATGTTCTAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTG
AACCAAGCTCCAAAACCGGTGAGTACAGAACCCTCTTATATCCGCTTTTGGAAACCTGGGGAGGTGGAAACCTTGGATTC
AGGCGTTGACTCAGCATCTCACAGCTCTGACATTGTACCCCTGTCTTCCACCATCTCCGAACTCCAGATACTCCTACAGC
GAAAGGGATCTGGGTCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTCATTTTATGGAGCTGAGACTTCCTACAAGCT
AGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAATGTTTGTTCTGCCTGCATTCCTAACTGGAGGATAA
ATTCCTGGAGACTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGCGAGGTGTTTTAGAGAAGTTCCACTTGCCAAG
GAATGAGCTCCTATAGGTCATGAAGCAACCCTGGCTGACTCAGCAGAGAAAGAGCCTTGCTGTAACAGAGAACAGAGCTC
ATGCACGCACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTCAGGCTGTGCACTGTGGAAGCTTTTCCTATT
GTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTTTTTAATTATCTTACAGTGCTGTAGCTCAAA
GTATGAAGTGCATCTCACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCTTCCCTCTGAGGATTCCAGGCAAGAATCTG
CTTCTCACTTTTCTCAGCTTCTAGAGGCTCCCACATTCCTTCGCTCCTGGTCCCCTTCCTCCTTCCTCAAAGCCCACAAA
GACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACACCTCTTTCTCTGAATGCTGCTCTCCCTTCT
TCCTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCATCATAATCTCCCGGAAATCATTCAG
GATACCCTTGTTTTAAGTTCAGCTGATTAGCAACCATAATTCCATCTGCAATCTTCATTCCTCCTTTCCATGTAAAATAA
GATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGCATTCTCCTGCCTTCCACAAACAGTGAAC
AAGATGCATTTGGCCTCTGCTCTTTGGACACTGATATTGCAGATGGTTAAATGGGAGGGCAGAAAATGAATGCACAAGTG
GACCAATAAATGAATGATCCATTGGGAAGCATCTGTGTATGAAATCTATTTGTTTGTTTCTTCATTTGTTTATTGAGACA
GAGTCTCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACCATCTTGGCTCACTGCAACCTGCACCTTCTGGATCCAAGTG
ATTCTCCTGCGTCAGCCTCTCAAGTAGCTGGGATTACAGGCAACTGCCACCATGCCCGGCTAATTCTTTTTGTATATTTT
TTGTAGAGGATGTTTCACCATCTTCGCCAAGCTTCTCTGAAACTCCCAACCTCAAGTGATCCGACCGTCTCAGCATCCTA
AAGTACTGGGATAACTGGCGTGAGCCACTGTGCCCAGCCAGAATTTAAAATAAATAATACATAATGCTGAGTGTATGATT
TTGGGTGACAGAGAAGATCTCACTAATCAGATATTTGTGACATTAATGAAAAACACGGATTGAACCCCTGAAAGATTGGC
GGAAGGATTTTCCACACACAGCTGTCAGCCGTGAAGGCAGAAAGCTGAAAACAATCTGATGTGGAAGGAAGAGGCTCTGC
CTCAAATGCTGGGAATGAGGTGGGGAGAATGACAAGACGACTGTGGAGAGACGGAGAGCACACTGGGTACACAGGAAACT
AAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACCTCGGGGTAGCCAGGAATCCCTACATGATTA
ATAGTGACTGACATGAAAATAAGGGAGGCCCAGGTGCGTAACTGGAATCTAGGAGACTGTGGAAAAGGCAATTCCCGCCC
CACTGGTGAAATGTGGTGCTGATTTAGACCCTAACTGGGTGAAGCAGATGGATATAAGCTATGCTTGTGAGGTGGAATCA
TTGGCTGGAAAGGCTTGCTGGGTATGATTTTCCTAGTTGTCTAATCCTCGCTTAATTTCTTTCTGAGCTTTATTCCTACT
ACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGGTGGTGGAAATGAAGGGACCTATTATAGCATAATA
TACAAGTCTGTGAACGGTGGCTCACGCCTGTAACCCAGCACTGCAGGAGGCCAAGGCGGGTGGATCACATGAAGTCAGCA
GTTCGAGACCAGCCTGGCCAACATGGTGAAACCCTGTCTCTAGGAAAAACACAAAAATTAGCCGAGCATGGTGGTGCATC
CCTGTAATCCCAGCTCCTACTCTGGAGGATGAAGCAGGAGAATGACTTCAACCCAGGAGGTGGAGGTTGCAGTGAGTGGA
GATTGCATCACTGCACTCCAGCCTGGGTGACACAAGGAGACTCCGTCTCAAAAAATAAAAATAAGAAATGCATAAATATA
AATATAATATAACACATGCAAATGAGAAAGGGACCTGAATTCCAATCATGATTTTTCTATTTCTCTATAATTACTTCTTT
GATCCTTTATCTTATCCATTAGGCAATGAGCCTAAAACCTCTTCCCTATTTGGCTTTCTGTGAGCATGAGATCATATAGA
AAATGTGAAAGCCCGCTGAATCCTCCAGCACAGATCCTGGAATACACAAAGTGCTCTGTTCATCACAAGAAAACATGCCC
TCTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCATCTGTGGAGATTCAGATAGGCCATGGGGAGGTAAATTCTAA
TACTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATTAGCGTCAGCAGTAGCTCCTGCTCCCCTTTCCTACTAATTCA
CAGGAGGACAGGTGGTATTGAAGCAATAGATGGCCGAGGGGGTGGTCCTTCCCCCAGCCTCTCGGGTAGAACAGCAACCT
AACATGTGTCTCCTGAGATCACAAAGAGTAGCACGTTTCACATGGGCTTCAACACTGTTTCCTGGCCATTTGACATAAGA
GAATTCTACTTCGCTTTTTTTATCTTGATTTCACTTTTGTTTCCTTTTCTTGGAGAATGCAAGTTGTTTGACTCAAGAAT
GCCGTGGATGTAGAAATCCTAAAGCACAGTCGCTGTGTATCAATCCCAGTGCAGTCTTCCCAGAGAAGACTCTAAACACC
TCCTGGACTGCACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTCCAGGGAGACAGAACACACAGAGAATACATT
ACACAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGCCTACATTTCAATGTGAGCCAGTCCCTCAAG
GCTCAGAAAAGCTGCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAGCTGGGGGAAGCCAGAAAGCAGCCCAGCCTG
GGTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGCCTTCCTCCAGGAAGAACAGGAAGACAG
CCCAGGCTGTTCTGAGACATTCCTCCTGATCTCAGGTCGTTGCTGTCTTAGTTTTTTTTTTTGTTGCTCTGAAGGAACAC
TTGAGCCTCGGTAACTTCTAAAGAAAAGAGATCGGTTTGCCTCACAGTTCTGCAGGCTGTACTGGAAGCATGGCACCAGA
ATCTATTTCTCGTGATGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAGAGACCACAGAG
ATCACACGGCAAGAGAGAGAGTAAGGGGGAGAGGGAGCAATGGAGCTTCCAAGCTCTTTTTAACAACCAGCTGTCCAGGA
ACTAACAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGATCTGTTCATGATGGATCCACCTCCATGACCC
AAACACCTCTGAAGAGGCCCAACCTCCCACAATGGGGGTGAAATTTCAATGTGAGGTTTGAAGGGGTCAAACATCTCAAC
TAAAGTAGTTGTATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAATTGAGAAAGCAGGGGAAAGCTAGGTCTCCC
GCCATTTGGGTGCTTGTCCTAAAGAGACGTTGTATGTGGTTACCTGCCAATCAAGAAATGCGAGACAATTCATAAAGAGG
AACTGCTATGATTAGCTTCTTATTGGTGTCTCCTCTTCTTCCAGGTAACCCCAGACACCTGCATGTTCTGATTGGGACCT
CAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCTCCAACAAAAAAAGTAAGTCTCAC
GAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCACTCAGGTGTGTGTTCCTCACCAGCAGGAT
GGTCCCTGGCCCAAGACAGGAGCCACAGAGGCAGGACTTTCTAGAGAGAGCACCAGATTCCCTTCCCCTGCCTTCAGCTC
ACAGACCGTTGCCTGATTCTGAACTGTACCCTCACGTCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCATGACAGGC
AGAAAGTGGGAGATAGAATCAATGGGATGGGAACTCAGAGCTATTCATGGGATGGGTCCTTGAACTCAGAGAGATAGAAT
GTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGGCACCTATGGCCTCCCCCTGTTTGTTGGTATCTGCTTATGAAATG
AGGACCCAGAAGTGCCCTCCGAGCTCTTTTGTTGACTTCCGTCTTCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCA
GGGAACAGAACAGTGAACAGCGAGGTAGGTGCTCCTCGGCCCAGCCTCGTGGCTAGTCTTATTCCCAAAGAGTCCTGAAA
AATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGATTCTGATGAACAAGACCATCAGGAGGTGTCATACGC
ATAATTGGATCACTGTGTTTTCACACAGAGAGAAATCACTCGCCCTTCTGAGAGGCCCAAGACACCCCCAACAGATACCA
GCATGTACATAGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTTCTGTCCACGAGCACCACAGTCAGGCCTTGAG
GGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATGTACCAGCAGCTGGAATCTGAAGGC
ATCAGTCTTCATCTTAGGGCATCGCTCTTCCTCACACCACGAATCTGAACATGCCTCTCTCTTGCTTACAAATGTCTAAG
GTCCCCACTGCCTGCTGGAGAGAAAACACACTCCTTTGCTTAGCCCACAATTCTCCATTTCACTTGACCCCTGCCCACCT
CTCCAACCTAACTAGCTTACTTCCTAGTCTACCTGAGGCTGCAATCACACTGAGGAACTCACAATTCCAAACATACAAGA
GGCTCCCTCTTAACACAGCACTTAGACACGTGCTGTTCCACCTCCCTTCAGACTATCTTTCAGCCTTCTGCCAGCAGTAA
AACTTATAAATTTTTTAAATAATTTCAATGTAGTTTTCCCGCCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR