Allele Report for 2DS2*0010102


2DS2*0010102
Previous Designations & Local Names: None
IPD Acc No: KIR00302
Assigned: 12-DEC-2007 Sequence Last Modified: 18-JAN-2008
Source Entries: AY320039 , GU182349  
Cells Sequence Derived From: G085 , WT47  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 2 Laboratories: 1
Protein Sequence (304 aa)
MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGV
SKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHL
SREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA
Nucleotide Sequence Data (915 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACATGAGGGAGTCCACAG
AAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCA
GGTTTGAGCACTTCCTTCTGCACAGAGAGGGGAAGTATAAGGACACTTTGCACCTCATTGGAGAGCACCATGATGGGGTC
TCCAAGGCCAACTTCTCCATCGGTCCCATGATGCAAGACCTTGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTC
CCCCTATCAGTTGTCAGCTCCCAGTGACCCTCTGGACATCGTCATCACAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTTTGGCAGGAGAGAGCGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTA
TCCAGGGAGGGGGAGGCCCATGAACGTAGGTTCTCTGCAGGGCCCAAGGTCAACGGAACATTCCAGGCCGACTTTCCTCT
GGGCCCTGCCACCCACGGAGGAACCTACAGATGCTTCGGCTCTTTCCGTGACTCTCCCTATGAGTGGTCAAACTCGAGTG
ACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTAAC
CCCAGACACCTGCATGTTCTGATTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCG
CTGGTGCTCCAACAAAAAAAATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGATTCTG
ATGAACAAGACCATCAGGAGGTGTCATACGCATAA
Genomic Sequence Data (14578 bps)
TTTAATGTAAGCACAGAATTCAATCATCTCGTGTATGAGAGGTTGGATCTGAGACGTCTTTTGAGTCTGGTCGTAGTGAA
GGACGCAAGGTGTCAATTCTAGTGAGAACAATTTCCAGGAAGCCATGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCA
TGCAAGGTAGAAAGAGCCTGCGTACGTCACCCTCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATA
ACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCGCGGCCGCCTGTCTGCACAGACAGCACCATGTCGCTCATGGTCGTCAG
CATGGCGTGTGTTGGTGAGTCCTGGAAGGGAATCGAGGGAGGGAGTGCGGGGATGGAGATCGGGGCCCAGAGTTGGAGAT
ATAGGCCTGGAAGTGGAGTTATGGGCCTAGAGATGGAGTGATGGGCCTAGAAGTGGAGATCTGGGCCTGGAGTGGAGATA
TGGGCCTGGAGGTTGAGATATGGGCCTGCAGTAGAGATATGGGCTTGTAGTGGAGACATGGGCCTGGAGATGGAGATATG
GGCCTGGAGATGGAGATATGGGCCTGCAGTAGAGATATGGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGAT
CTGGAGGTGGAGATACGGGCCTGCAGTAGAGATATGGGCCTGGAGTGGAGATATGGGCCAGGAGTGGAGTTATGGGCCTA
GAGGTGGATATCTGGGCCTGGAGTGGAGATATGGGCCTAGGAAGGAGATATGGGCCTGGGTGTGGAGATATGGGACTGGA
GAGGTGATATGGGCCTGGAGTGGAGATATGGGCTTAGGGTGGAGATCTGGGCCTGGGGCAGAGATATGGGACTGGATTGG
AGATATGGGCCTAGGGTGGAAATATCAGCCTGGAGTGGAGATATGGGCTTGTGGTGGGGATCTGGGCCTGGAAACTGGGT
CTCTGCACAGCCGACAGCCCTGTTCTTGGGTGCAGGTAGGCACTGAGGGTGAGTTTAACTTCAGCCCAGGAAGGGCCTGG
CTGCCAAGACTCACAGCCCAGTGGGGGCAGCAAGGGAGTCCTGGTTTGCCTGCAGATGGATGGTCCATCATGATCTTTCT
TTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACATGAGGGTGAGTCCTTCTCCAAACCTTCGGTTGTCATCTCCCCA
CATAAGAGGATTTTCCTGAAACAGGAGGGAAGTCCTGTCAGGGAGTCTCTCATAAACTGGGAAGAGAGGACCCTGGGGTG
CTCGGCCCACATTTCTGACCTTGCCTCCCTGGCCTCTCAACCCCTTGGCAGAGTCAAGTTCTGTGGGGACCAGGGTTAGA
CTGGGGTGCTCAAAGCTGGGGTGTGTGGTGGGGAAGTGGTAGGAACAGCAGATCCTCTGAGGACAAAGGTGTTACTCACA
CACTTCAGCGTTTCCATGATGGTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCAGAAGAGGTGGGAAACCACAGCCAT
GGCCCTGACATTCCAAATCCTCTGATGGGGGCTCAGTTGTTTATTTTCGTTCAGGCATCCGCTGATATCCACTCACAAAG
GACATGCCCTCCACCTCATGTCTACCCTGTGTTGTTTTATGTGAGTAATCTTACAGTATTAAAATCTAGTAGGAGTCTCT
TTACTCAGCACTTGCTCAAAGTTCTCAGCTGAGGCTTTTGTTGTAGGGAGACACCATGTCTTTGCGGGATGGGTCCTTCC
TTCAGCCCTGGGCACCAAGGTGTGATAGTAGCCATAGAAACGTGGAAAGCGAGGAGAATCTTCTGAGCACAGGGAGGGAG
GGGCAGTTCCACATCCTCCTCTCTAAGGCGGCGCCTCCTTCTCCCCAAGGTGGTCAGGACAAGCCCTTGCTGTCTGCCTG
GCCCAGCCTTGTGGTGCCTCTAGGACATGTCATTCTTCGGTGTCACTCTTATCTTGGGTTTAACAACTTCAGTCTGTACA
AGGAAGGTGGGGTGCCTGTCCCTGAGCTCTACAACAGAATATTCTGGAACAGCCTTTTCATGGGCCCTGTGACCCCCGCA
CAACAGGGACATACAGATGTCGGGGTTCACACACACACTCCCCCAGTGGGTGGTCAGCACCCAGCAACCCCCTGGTGATC
GTGGTCATAGGTCAGAGGGCTCCTGTCTTGGATTCTCCTTGTCCCACCTCCTGAATCCCAGAGCTTCTGGTGGGCATGTC
CTTGAGGGTCCCATCACGCAGGCCCTGACTGTATTTGTGGTAAAGGGGGATTGAATACAGGGAAATGGGTGCTGTGGTGG
GAAGAATAATTGTCCCCAGTGATGACTACATTCTAATCCCTGGAGTCTGTGACTATGTATGTTATAGGGGAAGGGACTGA
AGGGGAAGATGGAGCTCATGGGGAGACAGCCTGGACTGTCCCACTGGGCTCAGTGTAATCACAAGGGTGCACATGAAAGG
AGGAGGAAGAGGGGAGTGGGGATTAGAGCAGTCCAGTGGAAGTCTTCACCAGCTTTGAAGGTGGAGGAAGGCCAAGAGCC
ATGAATGCAGGTGGCCTATAGAGGCTGGAAAAGTCAAGGAACTGATTCTCCAGAGTCTCCAGAGGAAACGAAGCCCTGCA
GATGCCTTGATTTTAGCCCAGGAAAAATAGGGTCCAATTTCTGTCTCCAGTACTGGAAGGTGTCAGTGTGGTCTCTCCTG
CTTCCATGCTTCTGATAATTTTGTACAGCAGCAACAGGAAACCAACACTGGAACCCAGGTCAAGGACAAGTTAAGAAACA
ACCCAAGGAAAGCCAGGCATGGTGGCAGGCGCATGTAATCCTAGCGACTCAGGAGGCTGAGGGCAGGAGAATCACTTGAA
CCCAGGAAACAGAGGTTGCAGTGAGCCTAGACCACACCACTTCACTCCAGCCTGGGTGAAGGAGTGAGACTCTGTCTCCA
AAATTAATTAATTAATTAAAGAAACCAAACAAGGAGAAGGTTGGCTACCCTGAGATCAGCAAGGGTGGGATGATGATGCC
ACCACCAGGCTCCATCCACATAGGGAGGGGTTGATACTCCTCCAACCAGCACCAGGAGCCAGCCTATGGAAGCTGGCACC
ATGGAGAAGGCACAGGCATGGCAAGAGTGGCTCCCAGTCCCGACCAGGAACAGGGTGTGTGGACACTGGTGCCTGCCTTA
TTCATCAGTTCATACCTTCTGCCAAGGATTGCAATTCATCCAAAAGAGATTGAACAAGGCTGATAAGAGCCTGGATGTGC
AGCCTATCCTGGTTCCTCTTTCACCCCCACATAAACAGCAGGAAAGACGTTAGTGTGAAATAGATACAACACCCCAAGAG
ATGAGGCTAAGCCCAGTGGGAAGGGAATCAGAGGCTACTAGAGACAGAGGGACAGAGAAGAGGGAGGGAGACAGATGGAA
GGACCTGCACCAGGAGTTATGGGCACAGAAAAGAACATGAAGACACAGAGAGGAAGGAGAGAGACAGACACCAGCAAGGG
GAAGCCTCACTCATTCTAGGTGCCATGGATGGGATGATAAAGAGAGACACCTTCTAAACTCACAACCTCTCTTCTTAGGA
GTCCACAGAAAACCTTCCCTCCTGGCCCACCCAGGTCCCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTC
AGATGTCAGGTTTGAGCACTTCCTTCTGCACAGAGAGGGGAAGTATAAGGACACTTTGCACCTCATTGGAGAGCACCATG
ATGGGGTCTCCAAGGCCAACTTCTCCATCGGTCCCATGATGCAAGACCTTGCAGGGACCTACAGATGCTACGGTTCTGTT
ACTCACTCCCCCTATCAGTTGTCAGCTCCCAGTGACCCTCTGGACATCGTCATCACAGGTGAGAGTGTCCGGACATTCTC
ATTGTCATTGGGCTGCAGAGTGAATGATCCACGACTTGGAACCCCCAGGTAGTTGTAAGGAAGATGAGCTTGGTATTCTT
ATGGAGAGAGACTGACTTGCTGAGGTTTGTACCAACAGAGACAGAGAAACAGGAGACACAAGTACAGACCAGGTGTCATA
ACGGAGGACAGACACAGGGGCCATACAGGGAGTTAGAAAAGACAGAAAGAGTTAAAGGAGACAGACAGACAGACATGTCC
CAGAGAGAGGTGTCCCTCCATGCTGACTTTGCTCACAGACCTGGCACAGGATAGAAGTTTCATTTCTGTTTTACCTCCAC
AAAGTGTTCTCTACCAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGC
ACCTACAGGCCATGTTTATTCTGACACCTCTGCCTTCCATGTAATGGAGAGTAACCGTCCCAGGATATCATGGCCCCAGA
ACACCAACCCCTGTATGCTGTGTGAACTTGTGGTCTCCAGACTGGATTCTGAGGCTCACATTCCAAATAACCCCACATAT
GAAAGGATCACTGAGAGGCACAGAGAGAAATCAGGAACACCAAAAAGCAAAGACATAAACACACAGAGAATGGGCCAGAG
GAAGGAGATTGAGAGACTCACTGACACATAAAGAGAGAGAAAAGAGGGCAGAGGAGTGGTGAGAATGATGGAAGGGAGCA
GAGAAAAGCACTAAAATTAGAGTCCTGAGGGAGAGGCACAAGGACATAGAAAGATGGAGATGTGGGGATGAACTGCAGAG
ATTCCAAAGAGAACTAGAGAGACCGAGAGGCAGAGCAAGACAGATGATAGATGGATAGATATAGATAGATGATAAATAGG
TAGATGATAGATAATAGGTTAAAGATACATAGATGATGATTGATTGATTCATTAATAGATAATACATAGAGATGATGATG
ATGAAGACAGATAGATAATACGTACAGATAGAGAGGCAGACAGAAATCATAGAGAGAGAGATGATACATACATATAAATA
ACAGATGATTGATGGATAGATAGACAACTGATAGATACATAGATGATATATAGATATAGATGACAGGTAGAGAATTTGTA
GATAGGCACCGAATAGATAAATAGATAGATCGACAGATAATAGATAGAAATATGCAGAAAGTTATGAACAGGACACAACG
TGAGAAACTTAGAATTTAAAAAAGTAACATCAAGTCAACCAATCCAAGGAGAGTCAGAGAGAATAAAAGAATCCAAAAAG
GGAAAACATATCTAGAGGTGGGGAAGCGAGGTCAGAGACCTAGAGAGACAGAGAAGGTGGAAGGAGGAAATAGACATGAA
GAGAGATGGGGTGGAGGGTGAGAGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTG
AAGGGAGCTGTGACAAGGAAGATCCTCCCTGAGGAAAATGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCTCT
CAGCCCAGCCGGGCCCCACGGTTTTGGCAGGAGAGAGCGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTAC
CATCTATCCAGGGAGGGGGAGGCCCATGAACGTAGGTTCTCTGCAGGGCCCAAGGTCAACGGAACATTCCAGGCCGACTT
TCCTCTGGGCCCTGCCACCCACGGAGGAACCTACAGATGCTTCGGCTCTTTCCGTGACTCTCCCTATGAGTGGTCAAACT
CGAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAACCCCATATCTGTCTCATGTCCTATGATCCTAGAGCCTTAGC
TGAGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGACAGATGCAGAGAGAAGACGAAGCTTGGGTGTGAGGGAGGGATC
AGGGCACAGGATGGCAGACAGGGCACCTCCAAACCCTCCTACACGGCCTGCATGAAGGCCCGCGGCCAGGGCTCCAGGCA
CACAGGCAGATGGAGAAAACGGTCAGGAGAGACCCAGAGGAGAGAGACTGGGCTCAGTTTGGGAAGATCAGAGGTTCCCT
CAGCCCCTCAACATTATCCATTTCCCAGAAGCCCATCCTGGCCTCTCACCCACACAGGGATGTCATCACCAGCAACCCCT
ACACCCTTTACTTTTGTTTGAAGAAATATTTATTGAGGATAAATATACCTATATAGCTTACCACCTTTAACATTTTTTTT
TTTTTTGAGGCAGAGTCTAGCTCTGTCCCCTATGCTGGAGTGCAGTGGCACAATCTCAGCTCACTGCAATTTCCGCCTCC
TGGGTTCAAGCGATTCTCTTGCCTCAGCCACCTGAGTAGCTGGTGCTACAGGCGCGCACCACCACGCCAGGCTACTTTTT
GTATTTTTAGTAGAGAGGTGGTTTCACCATGTTGGTCGAGCTGGTCTCCAACTCCTGACCACGTGATCCACCCGCATGTG
CCTCCCAAAGTGCTGGGATTACAGGCATGAGCCACCACGCCCAGCCACATTTACCATTTTTAAGTGTAAAGTCTAGTGGT
CATAAATACATTTATATATATATATATTTTTTTTTTTTTTTTACCCTCCACCCTTTTCTTCCTGGCCTCTGGAAGCCATC
ATTCTACTCTCTACCTTCATGAGATCCACCTTTTAGCTCTGTATATGGGTGAGAAATGGGAATCTTTGTAATGACTTCCA
GTTCCATCCATGTGGCTGCAAATATCAGGATGTTATTCTTTCTATGGATGAGTAGTCTCCACTGTGCGTATGTACTACAT
TCTCTCTATCCATTCATCCACTGATGGGCAGGTAGGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGCACCAATCA
TACGAGTGCAGATATCACTTCGATATATTGATTTACTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGATACTAT
GAAAGTTCTCTTTTTAGTTTTTCGTTTGTTGTTTTGTTTTTGTTTTTGAGACAGTTTCCCTCTGTGCCCAGGCTGGAGTA
CAAGTGATGTCATCTTGGCTCATTGCAACCTCTGCCTCCTGGGTTCAAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCT
GGGATTACAGGTGCACGCCACCATGCCTGGCTACTTTTTGTTTTTTTTAGTATAGATGGGGTTTCCCCATGTTGGCTGGG
CTGCTCTCAAACTCATGACCTCAACTGAGATGCCCGCCTCAGTCTCCCAAAGTGCTGGGATTACAGGCCTGATCCACCAC
ACCCAACCTCTTTTTAGTTCTTTAAAGGACTTCCATACTTTTCTCCGTAATCGCTGTACTAATTTACACTCCTCCCAACA
GGGTACCAGGGTTCTCCTTTCTCTACCACCTTGCCAGCATTTCTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTTA
TTTCATTTTATTTTGAATGGAGTTTTGCTCTTCTCACCCAGGCAGGAGTGCAGTGGCGCTATCTCGGCTCACCACAACCT
CCACCTCCCAGGTTCAAGCGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGAATTACAGGCACACTCCACCACGCCCGAC
TAATTTTTGTATTTTTAGTAGAGACAGTGTTTCTCTATGTGGGTCAGACTGGTCTCAAACTCCTGACCTTATGAGATTCA
CCCACCTCAGGCTCTCAAAGTTCTAGGATGACAGACGTGAGCCACCACGCCCGGCCTAAAAGCCATTTTAATGGGGTGAG
ATGAAAACTCACTTTGATTTTAATTTGCGTTTCTCTGATGATGAGTGATACTGAGCACTTTTTAGTATGTGGGGAAATTT
CATGTCTTCTGCTCCTTTTTCAATTAAATCATTTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCTAGTTATTAATCC
CATCTCAGATGCATAGTTTGCACATATTTGCTCCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCAGT
GCAGAAGTTGCTTAGTTTGAGGTAATCCCAATGGTCTATTTTTGCTTCGATTACTTGTGTTTTCAAGGTTTAAAACAAAA
TGTCTTTCTTCAGACAAATGTCCTGGAGCATTTCCCCAATATTTTGTTCTACGTGTTTCATAGGTTCAGGCCTTAGACTC
ACATCTTTAATCCATTTTCATTTGATTTTTGTGTATGGTGACAGGTAGAGGTGCAGTTTCATTCCTCTGCATGTCGATGT
CCAGGTTTCCCTGCACTGTTTATTGAAAAGACTGTCCTTTCCTGATTGTGAGTTCTTGGCACCTTTGTCAAAGTCCATTG
GATGGGCTGGGCTTGGTGGCTGACACCTGCAATTTCAGCACTTTGGGAGGCCGAGGCGGGTGGATTACCTGAGGCCAGGA
GTTCAAGATCAGTCTGGACGACGTGATGAAACATCGTCTCCACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCA
CCTGTAATACCACTACTCAGGAGTTTGAGGCAAGAGAATGATTGAACCCAGGAGGCTGAGGTTGCAGTGAACTGAGATTG
CACCTCTGCACTCCAGCCTGAGTGACAGAGCAAGACTCCATCTCAAAAGAAAAAATAAAAAACCATTGGATGTAAATGCA
TGGAATATATCTGTGTTATTCATTCTGCTCCGTTGTTCTATGTCCCTTTCTTTATGCCAATGTCATGCTGTTTTGCTTAC
TACAGCTCTGTAACATATTTTGAGATCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTGAAGTCTCAAGACAGTG
GGCGTCACATAAAAAAATTATGGAAAAAAGGATCCCAGGACTCCCAGGGCCCAATATTAGATAACAGAGTGTTGGCCATG
AACCATCCTCAAAGATTTCCACTGAGTAGAGGACAGACACCCTCATTTCCTCACCTCTCTCCTGTCTCATGTTCTAGGAA
ACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTGAGTACAGAACCCTCTTATATCCGCTTTTG
GAAACCTGGGGAGGTGGAAACCTTGGATTCAGGCGTTGACTCAGCATCTCACAGCTCTGACATTGTACCCCTGTCTTCCA
CCATCTCCGAACTCCAGATACTCCTACAGCGAAAGGGATCTGGGTCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTC
ATTTTATGGAGCTGAGACTTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAATGTTT
GTTCTGCCTGCATTCCTAACTGGAGGATAAATTCCTGGAGACTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGCG
AGGTGTTTTAGAGAAGTTCCACTTGCCAAGGAATGAGCTCCTATAGGTCATGAAGCAACCCTGGCTGACTCAGCAGAGAA
AGAGCCTTGCTGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTC
AGGCTGTGCACTGTGGAAGCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTT
TTTAATTATCTTACAGTGCTGTAGCTCAAAGTATGAAGTGCATCTCACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCC
TTCCCTCTGAGGATTCCAGGCAAGAATCTGCTTCTCACTTTTCTCAGCTTCTAGAGGCTCCCACATTCCTTCGCTCCTGG
TCCCCTTCCTCCTTCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGACCCTTCTTCCTTACCACA
CCTCTTTCTCTGAATGCTGCTCTCCCTTCTTCCTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAA
ATCCATCATAATCTCCCGGAAATCATTCAGGATACCCTTGTTTTAAGTTCAGCTGATTAGCAACCATAATTCCATCTGCA
ATCTTCATTCCTCCTTTCCATGTAAAATAAGATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACA
GCATTCTCCTGCCTTCCACAAACAGTGAACAAGATGCATTTGGCCTCTGCTCTTTGGACACTGATATTGCAGATGGTTAA
ATGGGAGGGCAGAAAATGAATGCACAAGTGGACCAATAAATGAATGATCCATTGGGAAGCATCTGTGTATGAAATCTATT
TGTTTGTTTCTTCATTTGTTTATTGAGACAGAGTCTCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACCATCTTGGCTC
ACTGCAACCTGCACCTTCTGGATCCAAGTGATTCTCCTGCGTCAGCCTCTCAAGTAGCTGGGATTACAGGCAACTGCCAC
CATGCCCGGCTAATTCTTTTTGTATATTTTTTGTAGAGGATGTTTCACCATCTTCGCCAAGCTTCTCTGAAACTCCCAAC
CTCAAGTGATCCGACCGTCTCAGCATCCTAAAGTACTGGGATAACTGGCGTGAGCCACTGTGCCCAGCCAGAATTTAAAA
TAAATAATACATAATGCTGAGTGTATGATTTTGGGTGACAGAGAAGATCTCACTAATCAGATATTTGTGACATTAATGAA
AAACACGGATTGAACCCCTGAAAGATTGGCGGAAGGATTTTCCACACACAGCTGTCAGCCGTGAAGGCAGAAAGCTGAAA
ACAATCTGATGTGGAAGGAAGAGGCTCTGCCTCAAATGCTGGGAATGAGGTGGGGAGAATGACAAGACGACTGTGGAGAG
ACGGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACC
TCGGGGTAGCCAGGAATCCCTACATGATTAATAGTGACTGACATGAAAATAAGGGAGGCCCAGGTGCATAACTGGAATCT
AGGAGACTGTGGAAAAGGCAATTCCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACCCTAACTGGGTGAAGCAGATG
GATATAAGCTATGCTTGTGAGGTGGAATCATTGGCTGGAAAGGCTTGCTGGGTATGATTTTCCTAGTTGTCTAATCCTCG
CTTAATTTCTTTCTGAGCTTTATTCCTACTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGGTGGT
GGAAATGAAGGGACCTATTATAGCATAATATACAAGTCTGTGAACGGTGGCTCACGCCTGTAACCCAGCACTGCAGGAGG
CCAAGGCGGGTGGATCACATGAAGTCAGCAGTTCGAGACCAGCCTGGCCAACATGGTGAAACCCTGTCTCTAGGAAAAAC
ACAAAAATTAGCCGAGCATGGTGGTGCATCCCTGTAATCCCAGCTCCTACTCTGGAGGATGAAGCAGGAGAATGACTTCA
ACCCAGGAGGTGGAGGTTGCAGTGAGTGGAGATTGCATCACTGCACTCCAGCCTGGGTGACACAAGGAGACTCCGTCTCA
AAAAATAAAAATAAGAAATGCATAAATATAAATATAATATAACACATGCAAATGAGAAAGGGACCTGAATTCCAATCATG
ATTTTTCTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATGAGCCTAAAACCTCTTCCCTATT
TGGCTTTCTGTGAGCATGAGATCATATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCACAGATCCTGGAATACACAAA
GTGCTCTGTTCATCACAAGAAAACATGCCCTCTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCATCTGTGGAGAT
TCAGATAGGCCATGGGGAGGTAAATTCTAATACTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATTAGCGTCAGCAG
TAGCTCCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTATTGAAGCAATAGATGGCCGAGGGGGTGGTCCTT
CCCCCAGCCTCTCGGGTAGAACAGCAACCTAACATGTGTCTCCTGAGATCACAAAGAGTAGCACGTTTCACATGGGCTTC
AACACTGTTTCCTGGCCATTTGACATAAGAGAATTCTACTTCGCTTTTTTTATCTTGATTTCACTTTTGTTTCCTTTTCT
TGGAGAATGCAAGTTGTTTGACTCAAGAATGCCGTGGATGTAGAAATCCTAAAGCACAGTCGCTGTGTATCAATCCCAGT
GCAGTCTTCCCAGAGAAGACTCTAAACACCTCCTGGACTGCACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTC
CAGGGAGACAGAACACACAGAGAATACATTACACAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAGC
CTACATTTCAATGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTGCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAG
CTGGGGGAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGA
CGCCTTCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGAGACATTCCTCCTGATCTCAGGTCGTTGCTGTCTTA
GTTTTTTTTTTTGTTGCTCTGAAGGAACACTTGAGCCTCGGTAACTTCTAAAGAAAAGAGATCGGTTTGCCTCACAGTTC
TGCAGGCTGTACTGGAAGCATGGCACCAGAATCTATTTCTCGTGATGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAA
GGAGGGTCTGTCTGTGCAGAGACCACAGAGATCACACGGCAAGAGAGAGAGTAAGGGGGAGAGGGAGCAATGGAGCTTCC
AAGCTCTTTTTAACAACCAGCTGTCCAGGAACTAACAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGAT
CTGTTCATGATGGATCCACCTCCATGACCCAAACACCTCTGAAGAGGCCCAACCTCCCACAATGGGGGTGAAATTTCAAT
GTGAGGTTTGAAGGGGTCAAACATCTCAACTAAAGTAGTTGTATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAA
TTGAGAAAGCAGGGGAAAGCTAGGTCTCCCGCCATTTGGGTGCTTGTCCTAAAGAGACGTTGTATGTGGTTACCTGCCAA
TCAAGAAATGCGAGACAATTCATAAAGAGGAACTGCTATGATTAGCTTCTTATTGGTGTCTCCTCTTCTTCCAGGTAACC
CCAGACACCTGCATGTTCTGATTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGC
TGGTGCTCCAACAAAAAAAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGC
ACTCAGGTGTGTGTTCCTCACCAGCAGGATGGTCCCTGGCCCAAGACAGGAGCCACAGAGGCAGGACTTTCTAGAGAGAG
CACCAGATTCCCTTCCCCTGCCTTCAGCTCACAGACCGTTGCCTGATTCTGAACTGTACCCTCACGTCCCCTGCAGCCAC
TCACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGTGGGAGATAGAATCAATGGGATGGGAACTCAGAGCTATTCATGG
GATGGGTCCTTGAACTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGGCACCTATGGCCTCC
CCCTGTTTGTTGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTCTTTTGTTGACTTCCGTCTTCTACA
GATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGTAGGTGCTCCTCGGCCCAGCCTCGT
GGCTAGTCTTATTCCCAAAGAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGATTCTGA
TGAACAAGACCATCAGGAGGTGTCATACGCATAATTGGATCACTGTGTTTTCACACAGAGAGAAATCACTCGCCCTTCTG
AGAGGCCCAAGACACCCCCAACAGATACCAGCATGTACATAGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTTC
TGTCCACGAGCACCACAGTCAGGCCTTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCT
CCCATGTACCAGCAGCTGGAATCTGAAGGCATCAGTCTTCATCTTAGGGCATCGCTCTTCCTCACACCACGAATCTGAAC
ATGCCTCTCTCTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAGAAAACACACTCCTTTGCTTAGCCCACAA
TTCTCCATTTCACTTGACCCCTGCCCACCTCTCCAACCTAACTAGCTTACTTCCTAGTCTACCTGAGGCTGCAATCACAC
TGAGGAACTCACAATTCCAAACATACAAGAGGCTCCCTCTTAACACAGCACTTAGACACGTGCTGTTCCACCTCCCTTCA
GACTATCTTTCAGCCTTCTGCCAGCAGTAAAACTTATAAATTTTTTAAATAATTTCAATGTAGTTTTCCCGCCTTCAAAT
AAACATGTCTGCCCTCAT

IPD-KIR