Allele Report for 2DS1*0020105


2DS1*0020105
Previous Designations & Local Names: GRC212_AB
IPD Acc No: KIR00427
Assigned: 28-AUG-2009 Sequence Last Modified: 16-AUG-2010
Source Entries: GU182352  
Cells Sequence Derived From: GRC-212  
Known Ethnic Origin Of Source: American Indian
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (304 aa)
MSLTVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGV
SKANFSISRMKQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHL
SREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGN
PRHLHVLIGTSVVKIPFTILLFFLLHRWCSDKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA
Nucleotide Sequence Data (915 bps)
ATGTCGCTCACGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACATGAGGGAGTCCACAG
AAAACCTTCCCTCCTGGCCCACCCAGGTCGCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCA
TGTTTGAACACTTCCTTCTGCACAGAGAGGGGATGTTTAACGACACTTTGCGCCTCATTGGAGAACACCATGATGGGGTC
TCCAAGGCCAACTTCTCCATCAGTCGCATGAAGCAAGACCTGGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTC
CCCCTATCAGTTGTCAGCTCCCAGTGACCCTCTGGACATCGTGATCATAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTCTGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTA
TCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGGGACCAAGGTCAACGGAACATTCCAGGCCAACTTTCCTCT
GGGCCCTGCCACCCATGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGACTCTCCATACGAGTGGTCAAAGTCAAGTG
ACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCGAAACCGGTAAC
CCCAGACACCTACATGTTCTGATTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCG
CTGGTGCTCCGACAAAAAAAATGCTGCTGTAATGGACCAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGATTCTG
ATGAACAAGACCATCAGGAGGTGTCATACGCATAA
Genomic Sequence Data (14720 bps)
GTTCAGGAGGTTGGATCTGAGACGTGTTTTGAGTTGGTCATAGTGAAGGACGCTAGGTGTAAATTCTAGTGAGAACAATT
TCCAGGAAGCCGTGTTCCGCTCTTGAGCGAGCAACCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCCT
CCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCG
CGGCCGCCTGTCTGCACCGGCAGCACCATGTCGCTCACGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAGGGAAT
AGAGGAAGGGAGTGTGGGGTTGGAGATCTGGGCCCAGAGGTGGATATATAGGCCTGGAGGTGGAGTTGTGGGCCTGGAGT
GGAGATCTGGGCCTGGAGTGGATATATGGGCCTAGAGATGGAGTGATGGGCCTAGAAGTGGAGATCTGGGCCCAGAGGTC
GAGATATAGGCCTGGAGGTGGAGTGATGGGACTGTAGTGGAGATCTGGGCCTGGAGTGGAGATAGGAACCTGGAGGGGAG
ATAGGAACCTGGAGGGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGTCATGGGCCTGGAGGTGGAGTT
ACGGGCCTGCAGTAGAGATATGGGCCTGAAGTGGAGACATGGGCCTGGAGTGGAGATATGGGCCAGGAGTGGAGATATGG
GCCTAGAGGTCGATATCTGGGCCTGGAGTGGAGATATGGGCCAGGAGTGGAGATATGGGCCTAGAGGTCGATATCTGGGC
CTGGAGAGGAGATATGTGCCTAGGATGGAGATACGGGCCTGGGTGTGGAGATATGGGACTGGAGAGGATATATGGGCCTG
GAGTGGAGATATGGGACTGGAGAGGAGATATGGACCTGGAGTGGAGATAAGGGCCTGGATTGGAGATATGGGCCCAGGGT
GGAGATCTGAGCCTGGATTGGAGATATGGGCCTGGATTGGCGATATGGGCTTAGGGTGGAAATATCGGCCTGGAGTGGAG
ATATGGGCCTGGAGTGGAGATATGGGCTTGAGGTGGGGATATGGACCTGGAGGCTGGGTCTCTGCACAGCCGACAGCCCT
GTTCTTGGGTGCAGGTAGGCACTGAGGGTGAGTTTACCTTCAGCCCAGGAAGGGCCTGGCTACCAAGACTCACAGCCCAG
TGGGGGCAGCAAGGGTGCCCTGGTTTGCCTGCAGATGGGTCATCCATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGC
AGGGGGCCTGGCCACATGAGGGTGAGTCCTTCTCCAAACCTTCGGGTGTCATCTCCCCACATAAGAGGATTTTCCTGAAA
TGGGAGGGAAGTCCTGTCAGGGAGTCTCTCATAAACTAGGAAGAAGGGACCCTGGGGTGCTGGGCCCACATTTCTGACCT
TGCCTCCCTGGCCTTTCATTCCCTTGGCAGAGTCAAGTTCTGTGGGGACCAGGGTTAGACTATGGTGCTCAAAGCTGGGG
TGTGTGGTGGGGAAGTGGTAGGAACAGCAGATCCTCTGAGGACAAAGGTGTTACTCACACACTTCAGCGTTTCCATGACG
GTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCAGAAGAGGTGGGAAAACCACAGCCATGGCCCTGACATTCCAATCCT
CTGATGGGGACTCAGTTGTTTATTTTCGTTCAGGCATCGGCTGATATTCCATTCTCAAAGGACATGCCCTCCACCCCATG
TCTACCCTGTGTTGTTTTATGTGAGTAATCTTACAGTATTAAAATCTAGTAGGAGTCTCTTACTCAGCACTTGCTCAAAG
TTCTCAGCTGACACTTTTGTTGTAGGGAGACACCTTGTGTTTGCGGGATGGGTTCTTCCTTTAGCCCTGGGCACCAAGGT
GTGATAGCAGCCATAGAAACTTGGAAAGCGAGGAGAATCTTCAGAGCACAGGGAGGGAGGGGCGGCTCCACATCCTCCTC
TCTAAGGCGGTGCCTCCTTCTCCCCACGGTGGTCAGGACAAGCCCTTGCTGTCTGCCTGGCCAAGCCCTGTGGTGCCTCC
AGGATATGTGATTCTTCAGTGTCATTCTTATCTTGGGTTTAACAACTTCAGTCTGTAAAAGGAAGATGGGGTGCCTGTCC
CTGAGCTCTACAACATAATATTCTGGAACAGCCTTTTCATGGGCCCTGTGACCCCAGCACACGCAGGGACCTATACATGT
CGGGGTTCACAACCACACTACCCCAGTGGGTGGTCGGCACCCAGCAACCCCCTGGAGATCACGGTCACAGGTCAGAGGGC
TCCTGTCTGGGATTCTCCTTGTCCCACCTCCTGAATCCCAGAGCTCCTGGTGGGCGTGTCCTTGCGGGTCCCATCATGCA
AGTCCTGACTGTATTTGGGGTAAAGGGGGATTGAATACAGGGAAATGGGTGCTGTGGTGGGAAGAATAATTGTCCCCAGT
GATGACTACATTCTAATCCCTGGAGTCTGTGACTATTTATGATATAGGGGAAGGGACTGAAGGAGAAGATGGAGCTCAGG
TTGTTGATGAGTTGACCTTGAGATGGGGAGACAACCTGGACTGTCCTGATGGGCTCAGTGTAGTCACAGGGGTCCACAGG
AAAGGAGGAGGAAGAGGGGAGTGGGGATTACAGCAGCATAATGGGAGTCTCCATCAGCTTTGAAGGTGGAGGAAGTCCAG
GAGCCATGAATGCAGGTGGCCTATAGAGGCTGGAAAAGTCAAGGAACTGATTCTCCTGAGTCTCCAGAGGGAACGAAGCC
CTGCAGGTACCTTGATTTTACCCACGACAAACAGGGTCCGATTTCTGTCTCCAGAATTGGAAGGGGTTAGTGTGCTCTCT
CCTGCTGCCATGCTTCTGATAATTTTCTACAGCAGCAACAGGAAACCAACACTGGAACCCAGGTCAAGGACAAGTTAAGA
AACAACACAAGGATAGCCAGGCATGGTGGCAGGTGCATGTAATCCTAGCGACTTGGGAGGCTGAGGGCAGGAGAATCACT
TGAACCCAGGAGACAGAGGTTGCAGTAAGCCTAGACCACACCACTTCACTCCAGCCTGGGCAAAGGAGTGAGACTCTGTC
GCCAAAATTAATTAATTAATTAAAGAAACCAAACAAGGAGAAGGTTGGCTACACTGAGATCAGCAAGGCTCGGATGATGA
TGCCACCACCAGGCTCCATCCACATAGGGAGCGGTTGATACTCCTCCAACCAGCACCAGGAGCCAGGCTATGGAAGCTGG
CACTGGCATGGCAAGAGTGTCTCCCAGTCCCTACCAGGAACAGGGTGTGTGGCCACTGGTGCCTGCCTTACTGATCAGTT
CATACCTCCTGCCAAGGATTCCAATTCGTCCAAAAGAGATTGAACCAGGCTGCTAAGAGCCTGGATGTGCAGCCTATCCT
GGTTCCTCTTCCACCCCCACACAGACAGCAGGAAAGACATTAGTTCGAAATAGATACAACAGCCCAAGAGATGAGGCTGA
GCCCAGCGGCAAGGGAATCAGAGGCTACTAGAGACAGAGGGACAGAGAAGAGTGAGGGAGACAGATGGAAGGACCTGCAC
CAGGAGTTATGGGCACAGAAAAGAACATGAAGACACAGAGAGGAAGGAGAGAGATAAGACACCAGGAAGGGGAAGCCTGA
CTCAATCCAGGTGCCATGGATGGGATGATAAAGAGAGACACCTTCTAAACTCACAACCTCTCTTCCTAGGAGTCCACAGA
AAACCTTCCCTCCTGGCCCACCCAGGTCGCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCAT
GTTTGAACACTTCCTTCTGCACAGAGAGGGGATGTTTAACGACACTTTGCGCCTCATTGGAGAACACCATGATGGGGTCT
CCAAGGCCAACTTCTCCATCAGTCGCATGAAGCAAGACCTGGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTCC
CCCTATCAGTTGTCAGCTCCCAGTGACCCTCTGGACATCGTGATCATAGGTGAGAGTGTCCAGACTTTCTTCTCATTGTC
ATTGGGATGCAGAGTGAATGATCCAGGACTTGGAGGCCCAGGTGGCTGTAAGGAAGATGAGCTTGGTATTCTTATGGAGA
GAGACTGACTTGGTGAGGTCTGTGCCAACAGAGACAGAGAAACAGGAGACACAAGTAGAGACCAGGTGTCATAACAGAGA
ACAGACACAGGGGCCATACCGGGAGTTTGAAAAGACAGAAAGAGTTAAAGGAAACACACAGACAGACATGTCCCAGAGAG
AGGTGTCCCTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTGT
TCTCTACCAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCACCTACA
GATGCCATGTTTATTCTGACACCTCTGCCTTCCATGTAATGGAGAGTAATCGTCCCAGGATATCATGGCCCCACAACACC
AACCCCTGTATGCTGTGTGAACTTGTAGTCTCCAGACTGGATTCTGAGGCTCATATTCCAAATAAGCCCACTTATGAGAG
GATCAGTGAGAGGCACAGAGAGAAATCAGGGACACCAAAAAGCAAAGACATAAACACACAGAGAATGAGCCAGAGGAAGG
AGATTGAGAGACTCACAGACACATAAAGAGAAAAGAGGGCAGAGAAGTGAGAATGATGGAAGGGAGCAGAGAAAAGCACT
AAAATTAGACTCCTGAGGGAGAGGCACAAGGACATTGAAAGATGGAGATGTGGGGATGAATTGCAGAGATTCCAAAGAGA
ACTAGAGAGACCGAGAGGCAGAGCAAGACAGATGATAGATGGATAGATATAGATAGATGATAAATAGGTAGATGATAGAT
AATAGGTTATAGATACATAGATGATGATTGATTGATTCATTAATAGATGAGACATAGAGATGATGATGATGAAGACAGAT
AGATAGATAATACATAGAGATACAGAGGCAGACATAGAGAAATCATAGAGAGAGAGAGATGATACATAGATATAGATAAT
AGATGATTGATGGATAGATAGACAATTGATGGATAAATAGATGATATATAGATATAGATGACAGGTAGAGAATTTGTAGA
TAGGCACCGAATAGATAAATAGATAGATCGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACAGGACACAAAGTG
AGAAACTCAGAATTAAAAAAAGTAACATCAAGTCAACCAATCCAAGGAGAGTCAGAGAGAATAAAACAATCCAAAAAGAG
AAAACATATCTAGAGGTGGGGAAGTGAGGTCAGAGACCTAAAGAGACAGAGAAGGTGGAAGGAGGAAATAGACATGAAGA
GCGATGGGGTAGAGGGTGAGAGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTGAA
GGGAGCTGTGACAAGGAAGATCCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTCTCTCA
GCCCAGCCGGGCCCCACGGTTCTGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCA
TCTATCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGGGACCAAGGTCAACGGAACATTCCAGGCCAACTTTC
CTCTGGGCCCTGCCACCCATGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGACTCTCCATACGAGTGGTCAAAGTCA
AGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAGCCCATGGCTGTCCCATGTCCTATGATCCTAGAGCCTTAGCTG
AGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGACAGATGCAGAGAGAAGACGCAGCCTCGGTGTGAGGGAGGGATCAG
GGCACAGGATGGCCGACAGGGCACCTCCAAACCCTCCTACATGGCCTGCATGGAGGCCCACGGCCAGGGCTCCAGGCACC
CAGGCAGATGGAGAAAGCGGTCAGGAGAGACCCAGAGGAGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGTTCCCTCA
GCCCCTCAACCTTACCCATTTCCCAGAAGCCCATCCTGGACTCTCACCCACACAGAGATGTCATCACCAGCAACCCCTAC
ACCCTTTACTTTTCTTTGAAGAAATATTTATTGAGGATAAATATACCTATATAGCTTACCACTTTTAACATTTTTTTTTG
AGGTGGAGTCTAGCTGTGTCCCCTATGCTGGAGTGCAGTGGCACAATCTCAGCTCACTGCAACCTCCACCTCCTGGGTTC
AAGCGATTCTCCTGCCTCAGCCACCTGAGTAGCTGGTGCTACAGGCACGCACCACCACGCCAGGCTACTTTTTGTATTTT
TAGTAGGGAGGTGGTTTCACCATGTTGGTCGAGCTGGTCTCGAACTCCTGACCAAGTGATCCACCCGCATCTGCCTCCCA
AAGTGCTGGGATTACAGGCATGGGCCACCGCGCCCAGCCACATTTACCATTTTTAAGTGTAAAGTCTAGTGGTCATAAAT
ACATTTATATACATATATATATATATACATTTTTTTTACCCTCCACCCTTTTCTTCCTGTCCTCCAGTAGCCACCATTCT
ACTCTCTACCTTCATGAGATCCACCTTTTAGCTCCTGTATATGGGTGAGAAATGGGAATCTTTGTAATGACCTCCAGTTC
CATCCATGTGGCTGCAAATGACAGGATGTTATTCTTTCTATGGATGAGTAGTCTCCACTATGCGTATGTACTACATTCTC
TCTATCCATTTACCCACTGATGGGCAGGTAGGTTGACTCCTCATCTTGGCTACTGTGAACAGTGCTGCACCAATCATACG
AGTGCAGATATCACTTCGATATATTGATTTACTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGATACTATGAAA
GTTCTCTTTTTTTCTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGCCCAAGCTGGAGTCAAAGTGGTGCGACCTT
GGCTCATTGCAACCTACGCCTCCTGGGTTCAAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCTGGGATTACAGGTGCAC
ACCACCATGCCTGGCTACTTTTTGGTTTTTTTAGTATAGATGGGGTTTCCCCATGTTGGCTGGGCTGCTCTCAAACTCAT
GACCTCAACTGAGGTGCCCGCCTCAGTCTCCCAAAGTGCCGGGATTACAGGCATGATCCACCGCACCCAACCTCTTTTTA
GTTCTTTAAAGGACTTCCATACTTTTCTCCGTAATGGCTGTACTAATTTACACTCCTCCCAACAGGGTACCAGGGTTCTC
CTTTCTCTACCACCTTGCCAGCATTTCTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTTATTTCATTTTATTTTGA
GATGGAGTTTTGCTCTTCTCACCCAGGCTGGAGTGCAGTGGCGCGATCTCGGCTCACCACAACCTCCACCTCCCAGGTTC
AAGCGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGAATTACAGGCACACGCCACCACGCCCGACTAATTTTTGTATTTT
TAGTAGAGACAGTGTTTCTCTATGTGGGTCATACTGGTCTCAAACTCCCGACCTTATGAGATTCACCCACCTCAGGCTCT
CAAAGTTCTAGGATGACAAACGTGAGCCACCTCACCCGGCCTAAAAGCCATTTTAATGGGGTGAGATGAAAACTCACTTT
GAATTTAATTTGCGTTTCTCTGATGATGAGTGATACTGAGCAGTTTTTCGTATGTGGGGAAATTTCATGTCTTTTGCTCC
TTTTTCAATTAAATCATTTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCTAGTTATTAATCCCATCTCAGATGCATA
GTTTGCACATATTTGCTCCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCGGTGCAGAAGTTGCTTAG
TATGAGGTAATCCCAATGGTCTATTTTTGCTTCGATTACTTGTGTTTTCAAGGTTTAAAACAAAATGTCTTTCTTCAGAC
AAATGTCCTGGAGCATTTCCCCAATATTTTGTTCTACGTGTTTCATAGGTTCAGGCCTTAGACTCACATCTTTAATCCAT
TTTCATTTGATTTTTGTGTATGGTGACAGGTAGAGGTGCAGTTTCATTCCTCTGCATGTAGATGTCCAGGTTTCCCTGCA
CTGTTTATTGAAAAGACTGTCCTTTCCTGATTGTGAGTTCTTGGCATCTTTGTCAAAGTCCATTGGATGGGCTGGGCTTG
GTGGCTAACACCTGCAATTTCAGCACTTTGGGAGCCCGAGGTGGGTGGATCACCTGAGGCCAGGAGTTCAAGATTAGTCT
GGCCGACGTGATGAAACATCATCTCCACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCACCTGTAATACCACTA
CTCAGGAGTTTGAGGCAAGAGAATGATTGAACCCAGGAGGCTGAGGTTGCAGTGAACCGAGATTGCACCTTTGCACTCCA
GCCTGAGTGACAGAGCAAGACTCCATCTCAAAAGAAAAAATAAAAAACCATTGGATGTAAATGCATGGAATATATCTGTG
TTATTCATTCTGCTCCGTTGTTCTATGTGCCTTTCTTTATGCCAGTGTCATGCTATTTTGCTTACTACAGCTCTGTAACA
TATTTTGAGATCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTGAAGTCTCAAGACAGTGGGTGTCACATAAAAA
AATTATGGAAAAAAGGATCCCAGGACTCCCAGGGCCCAATATTAGATAACAGAGTGTTGGCCATGAACCATCCTCAAAGA
TTTCCACTGAGTGGAGGACAGAAACCCTCATTTCCTCACCTCTCTCCTGTCTCATGTTCTAGGAAACCCTTCAAATAGTT
GGCCTTCACCCACTGAACCAAGCTCCGAAACCGGTGAGTACAGAACCCTCTTATATCCGCTTTTGGAAACCTGGGGAGGT
GGAAACCTTGGATTCAGGCGTTGACTCAGCATCTCACAGCTCTGACATTGTACACCTGTCTTCCACCATCTCCGAACTCC
AGATACTCCTACAGCGAAAGGGATCTGGGCCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTCATTTTATGGAGCTGA
GACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAATGTTTGTTCTGCCTGCATTC
CTAACTGGAGGATAAATTCCTGGAGACTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGCGAGGTGTTTTAGAGAA
GTTCCACTTGCCAAGGAATGAGCTCCTGTAGGTCATGAAGCAACCCTGGCTGACTCAGCAGAGCAAGAGCCTTGCCGTAA
CAGAGAACAGAGCTCATGCACACACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTCAGGCTGTGCAGTGCG
GAACCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTTTTTAATTATCTTACA
GTGCTGTAGCTCAAAGTAGGAAGTGCATCTTACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCTTCCCTCTGAGGATT
CCAGGCACGAATCTGCTTCTCACTTGTCCCAGCTTCTAAAGGCTCCCAGTTCCTTGGCTCCTGGTCCCCTTCCTCCTTCC
TCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGTGCCTTCTTCCTTACCACACTTCTTTCTCTGAATG
CTGCTCTCCCTTCTTCCTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCCTCATAATCTCC
TGGAAATCATCCAGGATACCCTTGTTTTAAGTTCAGCTGATTAGTAACCATAATTCCATCTGCAATCTTCATTCCTCCTT
TCCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGCATTCTCCTGCCTTC
CACAAACAGTGAACAAGATGCATTTGGCCTCTGCCCTTGGGACACTGATATTGCAGATGGTTAAATGGGAGGGCAGAAAA
TGAATGCACAAGTGGATCTATAAATGAATGATCCATTGGGAAGCATCTGTGCATGAAATCTATTTTTTGTTTGTTCTTTT
GTTTATTGAGACAGAGTTGCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCACTGCAACCTGCTTCTC
CTGGATTCAAGTGATTCTCCTGCCTCCGCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCGTGCCCGGCTAATTCT
TTTTGTATATTTTTTGTAGAGAGGATGTTTCACCACGTTGGCCAAGCTTGTCTGAAACTCCCAACCTCAAGTGATCCGAC
CGTCTCAGCATGCCAAAGTAATGGGACTACAGGCGTGAGCCACTGTGCCCAGCCAGAATTCAAAATCAATAATAGATAAT
GCTGAGTGTATGATTTCAGGTGACAAAGAAGGTCTCACTATTCAGATATTTGTGACATTAATGAAAAACACGGATTGAAC
CCCTGAAAGATTGGCGGAAGGATTTTGCACACACAGCTGTCAGCCGTGAAGGCACAAAGGTGAAAACAATCTGATGTGGA
AGGAAGAGGCTCTTCCTCAAATGCTGGGAATGAGGTGGGGAGAATGACAAGACGACTGTGGAGAGACGGAGAGCACACTG
GGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACCTCGGGGTAACCAGGA
ATCCCTACATGATTAATATGACTGACATGAAAATAAAGGAGGCCCAGGGGCGTAACTGGAATCTAGGAGACCGTGGAAAA
GGCAATTCCCGACCCACTGGTGAAATGTGGTGCTGATTTTGACACTAAGTGGATGAAGCAGATGGATATAAGCTATGCTT
GTGAGGTAGAATCATTGGCTGGAAAGGCTTGCTGGGTTTGATTTTCCTACTTGTTTAATCCTCGCTTAATTAATTTCTTT
CTGAGATTTATTCATCCTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGGTGGTGGAAATGAAGAG
ACCTATTATAGCGTAATATACAAGTCTGTGAACGGTGGCTCACGCTTGTAACCCAGCACTGCAGGAGGCCAAGGCGGGTG
GATTCCATGAAGTCAGGAGTTCCAGACCAGCCTGGCCAACATGGTGAAACCCTATCTGTACTAAAAATACAAAAATTAGC
CGAGCATGGTGGTGCATCCCTGTAATCCCAGCTCCTACTCTGGAGGATGAAGCAGGAGAATGACTTCAACCCAGGAGGTG
GAGGTTGCAGTGAGTGGAGATTGCATCACTGCACTCCAGCCTGGGTGACACAAGGAGACTCCGTCTCAAAAAATAAAAAT
AAGAAATGCATAAATATAATAAAACACACACGAATGACAAAGGCACCTGAATTCCAATCATCATTTTTCTATTTCTCTAT
AATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATGAGCCTAAAACCTCTTCCCTATTTGGCTTTCTGTGAGCATG
AGATCACATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCACGGATCCTGGAATAGAGAAAGTGCTCTGTTCATCGCAA
AAAAAAACTTGCCCACTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCACCTGTGGAGATTCAGATAGACCATGGG
GAGGAAACATTAATACTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATCAGCGACAGCACTAGCTCCTGTTCCCCTT
TCCTACTAATTCACAGGAGGACAGGTGGTATTGAAGCAATAGATGGTGGAGGGGGTGGTCCTTCCCCCAGCCTCTCGGGT
AGAACAGCAGCCTAACATGTGTCTCCCGAGATCACAAAGAGCAGCACATTTCACACGGGCTTCAACACTATTTTCTGGCT
GTTTGACATAAGAGAATCTTGCTTCGCTATTTTTAATCGTGATTTCACCTTTGTTTCCTTTCCTTGGTGAATGCAATTTG
TTTGACTCAAGAATGCTGTGGATGTAGAAATCCTAAAGCACATTCGCTGTGTATCAATCCCAGTGCAGTCTTCCCAGAGA
AGACTCTAAACAAATCCTGGACTGCACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTCCAGGGAGACAGAACAC
ACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGTGAGTGACAACAGAAGCCTGCATTTCAATGTGA
GCCAGTCCCTCAAGGCTCAGAAAAGCTGCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAACTGGGGGAAGCCAGAA
AGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCTCCTCCAGGAA
GAACAGGAAGACAGCCCAGGCTGTTCTGAGACATTCCTCCTGATCTCAGGATGTTGCTATCTTAGTCCATTTTTGTTGCT
CTAAAGGAACACTTGAGCCTGGGTAACTTCTAAAGAAAAGAGATTGGTTTGCCTCACAGTTCTGCAGGCTGTACTGGAAG
CATGGCACCAGAATCTATTTCTCGTGATGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCA
GAGACCGCAGAGATCACACGGCAAGAGAGAGAGTAAGGGGGAGAGGGAGCGATGGAGCTTCCAAGCTCTTTTTAACAACC
AGCTCTCCAGGAACTAACAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGGTCTGTTCATGATGGATCCA
CCTCCATGACCCAAACACCTCTGAAGAGGCCCAACCTCCCACAATGGGGGTGAAATTTCAATGTGAGGTTTGAAAGGGTC
AAACATCTCAACTAAAGTAGTTGTATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAATTGAGAAAGCAGGGGAAA
GCTAGGTCTCCCGCCATTTGGGTGCTTGTCCTAAAGAGACGTTGTATGTGGTTACCTGCCAATCAAGAAATGCGAGACAA
TTCATAAAGAGGAACTGCTATGATTAGCTTCTTATTGGTGTCTCCTCTTCTTCCAGGTAACCCCAGACACCTACATGTTC
TGATTGGGACCTCAGTGGTCAAAATCCCTTTCACCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCTCCGACAAAAAA
AGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCACGCGGATGTGTGTTCCT
CACCAGCAGGATGGTCCCTGGCCCAAGACAGGAGCCACAGAGGCAGGACTTTCTAGAGAGAGCACCAGATTCCCTTCCCC
TGCCTTCAGCTCACAGACCATTGCCTGATTCTGAACTGTATCCTCACGTCCCCTGCAGCCACTCACATCCAGGAGAAGGT
TCCATGACAGGCAGAAAGTGGGAGATAGAATCAATGGGATGGGACCTCAGAGCTATTCATGGGATGGGTCCTTGAACTCA
GAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGGCACCTATGGCCTCCCCCTGTTTGTTGGTATCT
GCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTCTTTTGTTGACTTCCGTCTTCTACAGATGCTGCTGTAATGGAC
CAAGAGCCTGCAGGGAACAGAACAGTGAACAGCGAGGTAGGTGCTCCTCGGCCCAGCCTCGTGGCTAGTCTTATTCCCAA
AGAGTCCTGAAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGATTCTGATGAACAAGACCATCAGGA
GGTGTCATACGCATAATTGGATCACTGTGTTTTCACACAGAGAAAAATCACTCGCCCTTCTGAGAGGCCCAAGACACCCC
CAACAGATACCAGCATGTACATAGAACTTCCAAATGCTGAGCCCAGATCCAAAGTTGTCTTCTGTCCACGAGCACCACAG
TCAGGCCTTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATGTACCAGCAGCTG
GAATCTGAAGGCATCAGTCTTCATCTTAGGGCATCGCTCTTCCTCACACCACGAATCTGAACATGCCTCTCTCTTGCTTA
CAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAGAAAACACACTCCTTTGCTTAGCCCACAATTCTCCATTTCACTTGAC
CCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTACCTGAGGCTGCAATCACACTGAGGAACTCACAATTCC
AAACATACAAGAGGCTGCCTCTTAACACAGCACTTAGACACGTGCTGTTCCACCTCCCTTCAGACTATCTTTCAGCCTTC
TGCCAGCAGTAAAACTTATAAATTTTTTAAATAATTTCAATGTAGTTTTCCCGCCTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR