Allele Report for 2DL5B*0080101


2DL5B*0080101
Previous Designations & Local Names: RDP69
IPD Acc No: KIR00244
Assigned: 17-SEP-2007 Sequence Last Modified: 18-JAN-2008
Source Entries: EF379097 , EF473256 , GU182345  
Cells Sequence Derived From: FH13 , NMDP0003-3607-3 , RDP69  
Known Ethnic Origin Of Source: Black, Caucasoid
Publications
Du Z et al. Genes Immun 9:470-80 2008. abstract
Mulrooney TJ et al. Immunogenetics 60:287-294 2008. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
Protein Sequence (375 aa)
MSLMVVSMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSI
LMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGR
AHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH
ILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKT
PPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI
Nucleotide Sequence Data (1128 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGACACATGAGGGTGGTCAGGA
CAAGCCCTTGCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACATGTGACTCTTCTGTGTCGCTCTCGTCTTG
GGTTTACCATCTTCAGTCTGTACAAAGAAGATGGGGTGCCTGTCCCTGAGCTCTACAACAAAATATTCTGGAAGAGCATC
CTCATGGGCCCTGTGACCCCTGCACACGCAGGGACCTACAGATGTCGGGGTTCACACCCACGCTCCCCCATTGAGTGGTC
AGCACCCAGCAACCCCCTGGTGATCGTGGTCACAGGTCTATTTGGGAAACCTTCACTCTCAGCCCAGCCGGGCCCCACGG
TTCGCACAGGAGAGAACGTGACCTTGTCCTGCAGCTCCAGGAGCTCATTTGACATGTACCATCTATCCAGGGAGGGGAGG
GCCCATGAACCTAGGCTCCCTGCAGTGCCCAGCGTCAATGGAACATTCCAGGCTGACTTTCCTCTGGGCCCTGCCACCCA
CGGAGGGACCTACACATGCTTCGGCTCTCTCCATGACTCACCCTATGAGTGGTCAGACCCGAGTGACCCACTGCTTGTTT
CTGTCACAGGAAACTCTTCAAGTAGTTCATCTTCACCCACTGAACCAAGCTCCAAAACTGGTATCCGCAGACACCTGCAC
ATTCTGATTGGGACCTCAGTGGCTATCATCCTCTTCATCATCCTCTTCTTCTTTCTCCTTCATTGCTGCTGCTCCAACAA
AAAGAATGCTGCTGTAATGGACCAAGAGCCTGCCGGGGACAGAACAGTGAACAGGGAGGACTCTGATGATCAAGACCCTC
AGGAGGTGACATATGCACAGTTGGATCACTGCGTTTTCACACAGACAAAAATCACTTCCCCTTCTCAGAGGCCCAAGACA
CCTCCAACAGATACCACCATGTACATGGAACTTCCAAATGCTAAGCCAAGATCATTGTCTCCTGCCCATAAGCACCACAG
TCAGGCCTTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCTAGCTCCCATGTACCAGCAGCTG
GAATCTGA
Genomic Sequence Data (9979 bps)
CTTCCCTGGGAATTTAAATCATTTTAGCTGGTTCTGCTGTAATACTAGAAATACAAGCATGAAAAATTCTAATGGTTTAT
TAGTCACAATGACTCCGAAAACATTAATAATACCTATTAGATACTTTGCATATTACACAGGAAGAAGAGTTTGAATCTCA
GATAAAAACAAAAAAAATACATGAAAAGTCTTTCATGTTAGCACAGATTTTAGGCATCTCGTGTTCGGATAAAAATACAT
GAAAAGTCTTTCACGTTAGCACAGATTTTAGGCATCTTGTGTTCGGGAGGTTGGATCTGAGACGTGTTGTGAGTTGGTCA
TAGTGAAGGACGTGAGGTGCCAATTCTAGTGAGAACAATTTCCAGGAAGCCGTGTTCCGCTCTTGAGCAAGCATCCACTG
GGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCCTCCCATGATGTAGTCAACATGTAAGCTGCATGGGCAGGGCG
CCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCGCGGCTGCCTGTCTGCACCGGCAGCACCATGTCGCTCATGG
TCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAAGGAATAGAGGGAGGGAGCGCGGGGATGGAGATCTGGGCCCAGAGG
TGGAGATATAGGCCTGGAGGTGGAGTTATGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGATATATGGGCCTGGAGATG
GAGTGATGGGCCTAGAAGTGGAGATCTGGGTCTGGAGTGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGA
GATCTGGGCCTGGAGTGGAGATAGGAACCTGGAGGGGAGATATGAGCCTGGAGTGAAGATATTGGCCTGGGATGGAGATA
TGGGCCTGGAGTGGAGACATGGGCCTGGAGGTGGAGATATGGGCCTGGAGGTGGAGACATGGGCCTAGAGGTGGATATCT
GGGCCTGGAGTGGACATATGGGCCTAGGATGGAGATATGGGCCTGGGTGTGGAGATATGGGCTTGGGGTGGAGATATGGG
CCTGGATTGGAGATATGGGTCTAGGGTGGAAATATTGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCTTG
GGGTGGGGATAGGGGCCTGGGGTGCGGATATGGGCCTGCAGGCTGGGTCTCTACACAGCCGACAGCCCTGTTCTTGGGTG
CAGGCTGGCACTGAGGGTGAGTTTCCCTTCAGCCCAGCAAGGGCCTGGCTACCAAGACTCACAGCCCAGTGGGGGCAGCA
AGGGAGTCCTGGTTTGCCTGCAGATGGATGGTCCATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGG
ACACATGAGGGTGAGTCCTTCTCCAAACCTTCGGGTGTCATCTCCCCACATAAGAGGATTTTCCTGAAACAGGAGGGAAG
CCCGGTGGGGGATTTTCTTATAAACAAGGATGAGGAGACCCTGGGGTGCTCAGCCCACAGTTCCGACCTTGCCCTCCCCA
GCCTTCCTTTCCCTTGGCTGAGTCAGGTTCTGTGGGAACCCGGGAGGGTAGACTGGGGTCCTCCAAGCTGGGCTGTGCGA
CTGGGATGTGGTGTCACTGGCAGAGGAAGGGAGCAAAGCAGTGCTAGGAACAGCAGGCCTCTGAGGACAAAGGTGTAACT
CACACCCTCCAGCGTTTCCATGACGGTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCTCAGAGGTGGGGGAACCCCAG
CCAGGGCCCTGACCTTCCAAATCCTCTGTTGGGGGCTCAGTTGTGTATTGTGGTTCACACATTGGCTGATATTCCATTCA
CAAAGAACATGCCCTCGACTCCATGTCTATTTGTGTTGTTTTATGTGAGTAATCTTGCAGGATTAAAATCTAGTAGGAGT
CCCTTACTCAGCACTTGCTCAAAGTTCTCAGCTGACACTTTTGTTGTAGAGAGACGCCAAGTCTATGCGGGGTGGGTCCT
TCCCGTAGCCATGGGCACCCAAGTGTGGTAGGAGCCTTAGAAACGAGGAAAGTGGGGAGAATCTTCTGAGCACTGGCAGG
GAGGGGCGGCTCCACATCCTCCTTTCTAAGGTGGCGCCTCCTTCTCCCCCAGGTGGTCAGGACAAGCCCTTGCTGTCTGC
CTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACATGTGACTCTTCTGTGTCGCTCTCGTCTTGGGTTTACCATCTTCAGTC
TGTACAAAGAAGATGGGGTGCCTGTCCCTGAGCTCTACAACAAAATATTCTGGAAGAGCATCCTCATGGGCCCTGTGACC
CCTGCACACGCAGGGACCTACAGATGTCGGGGTTCACACCCACGCTCCCCCATTGAGTGGTCAGCACCCAGCAACCCCCT
GGTGATCGTGGTCACAGGTCAGAGGACTCATGTCTGGGCTTCTCCTTCTCCCACTTCCTGAATCCCAGAGCATCTGGTGG
GGGTGTCCACCAGGGTCCAATCATCCAGGCCCTGACTGTATTTGGTGTCAATGGGGATTGAATACAGGGGAATGGGTGCT
GTGGTGGAAAGAGTAACTGTCGGCAGCATGGCTATATTGTAATCCTTGGAGCCTGTGACTATTTATGTTATAGGACATGG
GACTGAAGGGGAAGATGGAGTTCAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGACGACCTGGACTCTCCCACTGGGC
TCAGTGTAATCACAAGGGTCCACATGAGAGGAGGAGGAAGAGGAGAGTGGGGATTAGAGCAGCGTAGTGGGAGGGAGAGT
CCACCAGCCACTGCGGGCTTTGAAAGTGGAGGAAGGCCAGAAGCCACGGAATGCAGGTGGCCTTTAGGGGCTGGAGAAGT
CAATGGAACTGATTCTCCCGAGTCTCCAGAGGGAATGCAGCCCTGCAGATGCCTTGATTGTAGCCCAGGAAGAACAGGGT
CTGATTTCTGTCAACAGAAGTGTTCTCTCCCGCCGCCGTGTTTGTGATAATTTTCTGCAGCAACAACAGGAAACAACACA
GGAATCCAGGTCAAGGACAAGTTAAAAAACCAAACAAGAGGGTTGGCTACCCTAAGGTCAGCAAGGGTGCACTGCTGATG
CCACCACCAGGCTGGAGCCGCATAGGGAGGGATCCACAGGGAGAGTCGGGGGTGGAGGGTGAGAGAGAGAGAGAGCATTA
GGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTGTGAGGGGAGCTGTGACAAGGAAGAACCTCCCTGAGGAAACTGC
CTCTTCTTCCAGGTCTATTTGGGAAACCTTCACTCTCAGCCCAGCCGGGCCCCACGGTTCGCACAGGAGAGAACGTGACC
TTGTCCTGCAGCTCCAGGAGCTCATTTGACATGTACCATCTATCCAGGGAGGGGAGGGCCCATGAACCTAGGCTCCCTGC
AGTGCCCAGCGTCAATGGAACATTCCAGGCTGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACACATGCTTCG
GCTCTCTCCATGACTCACCCTATGAGTGGTCAGACCCGAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAGCCCA
TGCCTGTCCCATGTCCTGTGATCCTAGAGCCTTAGCTGAGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGACAGATGC
AGAGAGAACACGCAGCATGGTGTGAGGGAGGGATCAGGGCACAGGATGGCAGACAGGGCACCTCCAAACCCTCCTGCACG
GCCTGCATGGAGGCCCGCGGCCAGGGCTCCAGGCACCCAGGCAGATGGAGAAAGTGGTCAGGACAGACCCAGAGGAGGGA
GACTCGGCTCAGTTTGGGGAGATCAGAGGCTCCCTCAGACCCTAAACCTTACCCATTTCCCAGAAGCCCATACTGGCCTC
TCACCCACACAGAGATGTCATCACCAGCAACCCCTACACCCTTTTCTTTCCGTTTGAAAAAACATTTATTTAGGTTAAAT
GTAACTATATAATTTGCCACCTTTACCATTTTTAAAAGTAAAATCTAGTGGTCATAAATTCCTTTATATGCAGGGTGCAG
TGGCTCACAGTTATAATCTCGGTGCTTTGAGAGGCCAAGGAAGGTGGATCATTTAAGATCAGAGGCTCGAGATCAGCCTG
GCCAACATGAGGGAAATTCATCTTTACTAAACAGACAAGAAAAATTGGCTGGGCATGCTGGCATGCACCTGTATTCCTAG
CTACATGGGAGGCTGAGGCAGGAGAAGTACGTAAGCCCAGGAGGCAGAGGTTGCACTGAGCTGAGATCAGGCCACTGCAC
TGCAGCCTGGGAGACAGAGAGAGATTCTGTCTCTAAATAAATAAATACATCTATATTCTTTTTTATTGTTGTTGTTACAC
TCCACCCTTTACTTCCTGCCCTCTGGTAGCCACCATTCTACTCTCTACCTTCATGAGATCCACCTTTTAGCTCCTGTATA
TGGGTGAGAAATGGGAATCTTTGCAATGACCTCCAGTTCCATCCATGTGGCTGCAAATGTCAGGATGTTATTCTTTCTAC
GGATGAGTACTCTCCACTGTGTGTGTGTACTACATTCTCTCTATCCATTCACCCACTGACGGGCAGGTAAGTTGACTCCA
CATCTTGGCTACTGTGAACAGTGCTGCACCAATCGTATGAGTGCAGATATCACTTCGATACACTGATGTCCTTCCCTTTG
GGTTTACACCCAGTAGTGGAATTGCTAGATCCTATCAACAGGGTACCAGGGTTCTCCTTTCTCTACCACCTTGCCAGCAT
TTATTTTGTCTGTGTTTCAGATAAAAGCCACTTTAATGGGATGAGATGATAGCTCACTGTGATTTCAATTGGCATGATTA
GTGATACTGAGCACTTTTTCATGTACATGTTCGCCATTTGTACGTTTTGTTTGTTGAGAAATGTCTGTTCAGGTCTTTTA
CTAATTGTTAAATTAAATTCATTGTTTTATACCGTTGCTTGAGTTTTATGTATATTCTAGTTATTAATCCCCTCTCAGAT
GCATACTTCACAAATATTTTCTCCCAATTTGTCTCTTCTTCACTTTGTTGGTTGCTTCCTTTGCGGTGCAGAAGCTGCTT
ACTTTGATGTAATCCCGAAGGTCTATTATTTTGTTTTGATTTCTTGTGTTTTTGAGATTTCAAATAAAATGTCTTTCCTC
AGACAAATGTCCTGGAGCATTTCCCCACTCTTTCCTTTTAGACGCTTAATGGTTTCAGGCCTTAAGTGTTTCTTCCATTT
TCATTTGATTTCTGTGTATGGTGAGAGGTAGAGGTGCAGTTTCATCAACTGCATGTAGATACCAGTTTTCCCTGCTCCAT
TTATTGAAAAGACCGTCGTTTCCTGATTGCAGGTTCTTGGCACGTACAATCGTCAAAGTCCATTGGATGTGAATGCATGA
ATTATATCTGTGTTCTTCATTCTGCTCCATTGCTCTAAGGGCCTTTATGCCAATGTCATGCTGTTGTGCTTACTACAGCT
TTGTAACATATTTTTAAGTCAGGGAGTGTGAGGCCTCCAGCACCTGTTTTGTCTTTATACCTCGAAATCTCAGGACACTG
GGCATCATTTAACAATGATGATGGAGAAGGGGACGCCAGGACTCCTAGGGCCCAACATTAGATAACAGAGTGTTGGCCAT
GAACCAACCTCAAAGATTTCCTTTGAGTAGAAGACAGGCATCCTCATTTCCTCACCTCTCTCCTGTCCTGTGTTCTAGGA
AACTCTTCAAGTAGTTCATCTTCACCCACTGAACCAAGCTCCAAAACTGGTGAGTAAAGATCCCTCTTATCTCTGCTTTT
GGAAACCTGGGGAGGTTGGTATCTTGGATTCAAGCATTGGCTCAGCACCTCCCAGCTCTGTGATTGTGGGCCTGTCTTCT
AACATCTCTGACCCCCAGACACTACAACAGCGAAGGGTATCTGAGGACAGCAAAGGGCTCAGTGAAGTCTCTTCATTTCA
AATTTCTGCAGCTGAGACCTCCTCCAAGCTAGACGGACGAGTACAAATCTGACATCCTTCTCAGGGATAAAGTGGTGTTT
TTTCTGCCTGCATTCCAAATTGGAGGATAAATTTGAGGGGACTTGAGAGAGGGAGGGGAAGGGAACATCTGATGAGGGAA
AGGTGATTTAGAGAAGTTCCACTTGCCAAGGAATGAGCCCCTGTTGGTCATGATGCGACCTTGGCTGAGTCAGCAGAGCA
AGAGCCTTGCAGTAAGAAGGAACGTAGTTCATCCACAAATATGACACTTCCACTTACTCACTTATTCAGCCACTGCCCTG
TGCTCTGACTGTACAGTGTGGAACCCTTTCCTGCTGTTGCCATAATAAATCTCCACAAACTTCATGGATGACAACAACAC
AGCTTTTAAAATTATCTTACAGTGTTATAGCTCAGAAATATGAAATGCATTTCACTGGGCTAAAATCAAGGTGACTGCGA
GGCTGCCTTTTCTCTGAAGGTTCCAGGCGAGAATCGGCTTTTCACATTTCCCAGCTCCCAGAGGTTCCCACGTTCCTTGG
CATCTGGTCCCCATCCTCCTTCCTCGAAGCCCACAAAAGCTCATCACATCTCTCACGTGGCATCACTCAGATCCCTCTTC
CTTACCTCACCTCTTTCTCTAAGTGTTGCTCTGACTTTTTCTTCCTCTTTTAAAGACTTTGGGATTCTATTGAGTTTACC
AAGATAATCCATCACAATCTCCCTAAAATCACCCAAGATAACCTCTTTTTAAGTTCAGCTGATTAGCAACCATAATTCCA
TCTGCAATCTTTATTCCTCCTTTCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGGT
GGGCCAGCATTCTCCTGCCTTCCACAAATGGTAAACACGATGCATTTGGCCTCTGCTCTTAGGACACTGACATTGCAGAT
GGGCAAATGGGAGGGCAGAATATGAATGCACAAGTGGACCAGTAATGATTGATCCATTGGGAAGCATCCGTGCATGAAAT
CTATTTACCTATTTATTTATCTATTTATCTATTTATGTATTTATTTATTTGCGGCGAAGTCATTCTCTGTCCCCGGGCTG
GAGTGCAGTGGCATGACCTCAGCTCACCACAACCTCCGCCTCCCGGGTTCAGGCGATTCTCCTGCCTCAGCCTCCTGACT
AGTTGTGATTCCAGTCCCCTCCACCACACCCAGCTAATATTCTTTTATATTTTTTAGTAGAGATGGAGTTTCACCATGTT
GCGCAGATTGTCTCCAACTCCCAACCTCAAGTGATCCGACCGTCTCAGCATCCCAAAATGCTGGGACTCAAGGTGTGAGA
CACTGCGCCCAGCCGAAATTTAAAATAAATAATAAAGAATTCTAAGTGTATAATTTCAGGAGACAGAGAAAGTCTCACTA
ATCAGATAATATTTGTGACCATAATGAAAAAAAAAAGTAGATTCAACCCCTGGAAGATTGGCGGAAGGATTTTCCACACA
CAGCTGTCAGCCGTGAAGGCACAAATGTGAAAACAATCTGATGTGGAAGGAAGAGGCTCTGCATTCAAATGCTGGGAATG
ACGTGGGGAGAATGACAAGACGACTGTGGAGAGACGGAGAGCACTCTGGGTACACAGGAAACTAAGGAGGAACAAGGAGC
GTGTGTTTGACACTCACAGCCATTGGATTCACCTCGGGGTAGCCAGGAATCCCTACATGATTAATATGACTGACATGAAA
ATAAGGACGCCCAAGTGCGTAACTGGAATCTAGGAGACCGTGGAAAAGGCAATTCCCGCCCCACTGGTGAAATGTGGTGC
TGATTTAGACACTAAATGAATGAAGTAGATGGGTATAAGATATGTCTGTGAGGTAGAATCATTTGTAGGGAGGGCTTGCT
GGATTTGATAATGCCTACTTATTTAATTTTGAATATATTAATTTCTTTCTGAGATTTATTTTTCCTACATGTAAATCAAT
ATCTGGCAGAGGAGTGATTGATAGATAGATGAGGGGTGGTGCAAATGAAGGGACTTATTATAGCATAATATACAAGTCTG
TGAATGGGAGCTTACGCCTGTAACCCAACACTTTGGGAGGCCAAGGCGTTTGGATCACTTGAGGTCAGGAGTTTGAGACC
AGCCTGGCCAACATGGAGAAACCCCATGCTCTTTTTAGCAACCAGTCCTAGGGACCTCATGGAGAACTTGCCAACCACGT
CTCATGGGGACAGCATTAATGTATTCATGATGGATCCACCCCCATAACTGGAACGTCTCTCAATAGGCCCAGCCTCCCAC
ACTGCGAGATAAGTGTCAACGTGAGGTTTGGCGGGGTCAAACATCCAAACTATAGCAGTGGTATCCCCAGCATGTTCTCT
GATTATTTTGAGAACTATAACTGAGAAAGCAGGAGAAAGCTGGGTATCCTGCCATCGGGGAACTTGTCCTAAACAGATGT
TGTATGTGCTTAGCTGGCAACCAAGAAATGAGAGACAATCCATAAAGAGGAACTGCTATAATTAGCTTCTTATTGGATTC
CCACCTTCCCCCAGGTATCCGCAGACACCTGCACATTCTGATTGGGACCTCAGTGGCTATCATCCTCTTCATCATCCTCT
TCTTCTTTCTCCTTCATTGCTGCTGCTCCAACAAAAAGAGTAAGTCTCACGAAGCAGAGGTCAGAGAGCTCAGGACCATG
TGGGGAAGCAGGATGGGAGCACACTGGTGTGTGTTCCTGACTGGCAGGATGGTCCCTGGACCAAGGCAGGAGCCACAGAG
GCAGGGCTTTCTAGAGAGAGCACCAGACACCCTGCCCCTGCCTTCAGCTCACAGACCATTGCCTGATTCTGAACTGTATC
CTCACGTCCCCTGCAGCCACTGACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGGGGAGACAGAATCACTGGGATGGG
AACTCAGAGCTATTCATGGGATGGGTCCTTGAGCTCAGAGAGATAGAATGTCTGGGTCTGGCTGATGACAGCTGAGGGAC
CTCAGGCACCTACGGCCTCCCGCTGTGTGTTGGTGTCTGCTCATGAAATGAGGACCCAAAAGTGCCCTTCCAGCTGTTTT
GATGACTTCTATCTCCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCCGGGGACAGAACAGTGAACAGGGAGGTAGGT
TCTCCTCAGCCCAGCCTCATGGATTGAGTCTCATTCCCTAATAGTCTTGAAGAATGTGAGCACCCTCCCTCACTCAGCAT
TTCCCTCTCTCCAGGACTCTGATGATCAAGACCCTCAGGAGGTGACATATGCACAGTTGGATCACTGCGTTTTCACACAG
ACAAAAATCACTTCCCCTTCTCAGAGGCCCAAGACACCTCCAACAGATACCACCATGTACATGGAACTTCCAAATGCTAA
GCCAAGATCATTGTCTCCTGCCCATAAGCACCACAGTCAGGCCTTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTCTC
AAAACCGGGTTGCTAGCTCCCATGTACCAGCAGCTGGAATCTGAAGGCATCAGTCTTCATCTTAGGGGATCGCTCTTCCT
CACACCACAAATCTGAACATGCCTCTCTCTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAGAAGACACACT
CCTTTGCTTAGCCCACAATTCTCTATTTCACTTGACCCCTGCCCACCTCTCCAACTGAACTGGCTTACTTCCTAGTCTAC
TTGAGGCTGCAATCACACTGAGGAACTCACAATTCCAGACATACAAGAGGCTCCCTCTTAACATGGCACTGAGACACGTG
CTGTTCCACCTTCCCTCATGCTGTTTCACCTTTCCTCAGACTATTTTCCAGCCTTCTGTCAGTCAGCAGTGAAACTTATA
AAATTTTTTGTGATTTCAATGTAGCTGTCTCCTTTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR