Allele Report for 2DL5B*00601


2DL5B*00601
Previous Designations & Local Names: KIR2DL5-GB11
IPD Acc No: KIR00125
Assigned: 31-MAR-2005 Sequence Last Modified: 10-MAR-2006
Source Entries: AJ871282 , AJ871283 , AJ871284 , AJ871285 , EU450880 , GU182343  
Cells Sequence Derived From: FH08 , GB11 , UCLA439  
Known Ethnic Origin Of Source: Black
Publications
Gomez-Lozano N et al. Eur J Immunol 37:1954-65 2007. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
Protein Sequence (375 aa)
MSLMVVSMACVGFFLLQGAWPHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSI
LMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGR
AHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH
ILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKT
PPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI
Nucleotide Sequence Data (1128 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACATGAGGGTGGTCAGGA
CAAGCCCTTGCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACATGTGACTCTTCTGTGTCGCTCTCGTCTTG
GGTTTACCATCTTCAGTCTGTACAAAGAAGATGGGGTGCCTGTCCCTGAGCTCTACAACAAAATATTCTGGAAGAGCATC
CTCATGGGCCCTGTGACCCCTGCACACGCAGGGACCTACAGATGTCGGGGTTCACACCCACGCTCCCCCATTGAGTGGTC
AGCACCCAGCAACCCCCTGGTGATCGTGGTCACAGGTCTATTTGGGAAACCTTCACTCTCAGCCCAGCCGGGCCCCACGG
TTCGCACAGGAGAGAACGTGACCTTGTCCTGCAGCTCCAGGAGCTCATTTGACATGTACCATCTATCCAGGGAGGGGAGG
GCCCATGAACCTAGGCTCCCTGCAGTGCCCAGCGTCAATGGAACATTCCAGGCTGACTTTCCTCTGGGCCCTGCCACCCA
CGGAGGGACCTACACATGCTTCGGCTCTCTCCATGACTCACCCTATGAGTGGTCAGACCCGAGTGACCCACTGCTTGTTT
CTGTCACAGGAAACTCTTCAAGTAGTTCATCTTCACCCACTGAACCAAGCTCCAAAACTGGTATCCGCAGACACCTGCAC
ATTCTGATTGGGACCTCAGTGGCTATCATCCTCTTCATCATCCTCTTCTTCTTTCTCCTTCATTGCTGCTGCTCCAACAA
AAAGAATGCTGCTGTAATGGACCAAGAGCCTGCCGGGGACAGAACAGTGAACAGGGAGGACTCTGATGATCAAGACCCTC
AGGAGGTGACATATGCACAGTTGGATCACTGCGTTTTCACACAGACAAAAATCACTTCCCCTTCTCAGAGGCCCAAGACA
CCTCCAACAGATACCACCATGTACATGGAACTTCCAAATGCTAAGCCAAGATCATTGTCTCCTGCCCATAAGCACCACAG
TCAGGCCTTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCTAGCTCCCATGTACCAGCAGCTG
GAATCTGA
Genomic Sequence Data (10096 bps)
CTTCCCTGGGAATTTAAATCATTTTAGCTGGTTCTGCTGTAATACTAGAAATACAAGCATGAAAAATTCTAATGGTTTAT
TAGTCACAATGACTCCGAAAACATTAATAATACCTATTAGATACTTTGCATATTACACAGGAAGAAGAGTTTGAATCTCA
GATAAAAACAAAAAAAATACATGAAAAGTCTTTCATGTTAGCACAGATTTTAGGCATCTCGTGTTCGGATAAAAATACAT
GAAAAGTCTTTCACGTTAGCACAGATTTTAGGCATCTTGTGTTCGGGAGGTTGGATCTGAGACGTGTTGTGAGTTGGTCA
TAGTGAAGGACGTGAGGTGCCAATTCTAGTGAGAACAATTTCCAGGAAGCCGTGTTCCGCTCTTGAGCAAGCATCCACTG
GGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCCTCCCATGATGTAGTCAACATGTAAGCTGCATGGGCAGGGCG
CCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCGCGGCCGCCTGTCTGCACCGGCAGCACCATGTCGCTCATGG
TCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAAGGAATAGAGGGAGGGAGCGCGGGGATGGAGATCTGGGCCCAGAGG
TGGAGATATAGGCCTGGAGGTGGAGTTATGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGATATATGGGCCTGGAGATG
GAGTGATGGGCCTAGAAGTGGAGATCTGGGTCTGGAGTGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGA
GATCTGGGCCTGGAGTGGAGATAGGAACCTGGAGGGGAGATATGAGCCTGGAGTGAAGATATTGGCCTGGGATGGAGATA
TGGGCCTGGAGTGGAGACATGGGCCTGGAGGTGGAGATATGGGCCTGGAGGTGGAGACATGGGCCTAGAGGTGGATATCT
GGGCCTGGAGTGGACATATGGGCCTAGGATGGAGATATGGGCCTGGGTGTGGAGATATGGGCTTGGGGTGGAGACATGGG
CCTGGAGGTGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTAGAGGTGGATATCTGGGCCTGGAGTGGACATATGGGC
CTAGGATGGAGATATGGGCTTGGGGTGGAGATATGGGCCTGGATTGGAGATATGGGTCTAGGGTGGAAATATTGGCCTGG
AGTGGAGATATGGGCCTGGAGTGGAGATATGGGCTTGGGGTGGGGATATGGGCCTGGGGTGCGGATATGGGCCTGCAGGC
TGGGTCTCTACACAGCCGACAGCCCTGTTCTTGGGTGCAGGCTGGCACTGAGGGTGAGTTTCCCTTCAGCCCAGCAAGGG
CCTGGCTACCAAGACTCACAGCCCAGTGGGGGCAGCAAGGGAGTCCTGGTTTGCCTGCAGATGGATGGTCCATCATGATC
TTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACATGAGGGTGAGTCCTTCTCCAAACCTTCGGGTGTCATCT
CCCCACATAAGAGGATTTTCCTGAAACAGGACGGAAGCCCGGTGGGGGATTTTCTTATAAACAAGGAAGAGGAGACCCTG
GGGTGCTCAGCCCACAGTTCCGACCTTGCCCTCCCCAGCCTTCCTTTCCCTTGGCTGAGTCAGGTTCTGTGGGAACCCGG
GAGGGTAGACTGGGGTCCTCCAAGCTGGGCTGTGCGGCTGGGATGTGGTGTCACTGGCAGAGGAAGGGAGCAAAGCAGTG
CTAGGAACAGCAGGCCTCTGAGGACAAAGGTGTAACTCACACCCTCCAGCGTTTCCATGACGGTAGGGGCTGCAGTGTGG
CTGCTGTCATTCTACCTCAGAGGTGGGGGAACCCCAGCCAGGGCCCTGACCTTCCAAATCCTCTGTTGGGGGCTCAGTTG
TGTATTGTGGTTCACACATTGGCTGATATTCCATTCACAAAGAACATGCCCTCAACTCCATGTCTATTTGTGTTGTTTTA
TGTGAGTAATCTTGCAGGATTAAAATCTAGTAGGAGTCCCTTACTCAGCACTTGCTCAAAGTTCTCAGCTGACACTTTTG
TTGTAGAGAGACGCCAAGTCTATGCGGGGTGGGTCCTTCCCGTAGCCATGGGCACCCAAGTGTGGTAGGAGCCTTAGAAA
CGAGGAAAGTGGGGAGAATCTTCTGAGCACTGGCAGGGAGGGGCGGCTCCACATCCTCCTTTCTAAGGTGGCGCCTCCTT
CTCCCCCAGGTGGTCAGGACAAGCCCTTGCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACATGTGACTCTT
CTGTGTCGCTCTCGTCTTGGGTTTACCATCTTCAGTCTGTACAAAGAAGATGGGGTGCCTGTCCCTGAGCTCTACAACAA
AATATTCTGGAAGAGCATCCTCATGGGCCCTGTGACCCCTGCACACGCAGGGACCTACAGATGTCGGGGTTCACACCCAC
GCTCCCCCATTGAGTGGTCAGCACCCAGCAACCCCCTGGTGATCGTGGTCACAGGTCAGAGGACTCATGTCTGGGCTTCT
CCTTCTCCCACTTCCTGAATCCCAGAGCATCTGGTGGGGGTGTCCACCAGGGTCCAATCATCCAGGCCCTGACTGTATTT
GGTGTCAATGGGGATTGAATACAGGGGAATGGGTGCTGTGGTGGAAAGAGTAACTGTCGGCAGCATGGCTATATTGTAAT
CCTTGGAGCCTGTGACTATTTATGTTATAGGACATGGGACTGAAGGGGAAGATGGAGTTCAGGTTGTTGATGAGTTGACC
TTGAGATGGGGAGACGACCTGGACTCTCCCACTGGGCTCAGTGTAATCACAAGGGTCCACATGAGAGGAGGAGGAAGAGG
AGAGTGGGGATTAGAGCAGCGTAGTGGGAGGGAGAGTCCACCAGCCACTGCGGGCTTTGAAAGTGGAGGAAGGCCAGAAG
CCACGGAATGCAGGTGGCCTTTAGGGGCTGGAGAAGTCAATGGAACTGATTCTCCCGAGTCTCCAGAGGGAATGCAGCCC
TGCAGATGCCTTGATTGTAGCCCAGGAAGAACAGGGTCTGATTTCTGTCAACAGAAGTGTTCTCTCCCGCCGCCATGTTT
GTGATAATTTTCTGCAGCAACAACAGGAAACAACACAGGAATCCAGGTCAAGGACAAGTTAAAAAACCAAACAAGAGGGT
TGGCTACCCTAAGGTCAGCAAGGGTGCACTGCTGATGCCACCACCAGGCTGGAGCCGCATAGGGAGGGATCCACAGGGAG
AGTCGGGGGTGGAGGGTGAGAGAGAGAGAGAGCATTAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTGTGAGGG
GAGCTGTGACAAGGAAGAACCTCCCTGAGGAAACTGCCTCTTCTTCCAGGTCTATTTGGGAAACCTTCACTCTCAGCCCA
GCCGGGCCCCACGGTTCGCACAGGAGAGAACGTGACCTTGTCCTGCAGCTCCAGGAGCTCATTTGACATGTACCATCTAT
CCAGGGAGGGGAGGGCCCATGAACCTAGGCTCCCTGCAGTGCCCAGCGTCAATGGAACATTCCAGGCTGACTTTCCTCTG
GGCCCTGCCACCCACGGAGGGACCTACACATGCTTCGGCTCTCTCCATGACTCACCCTATGAGTGGTCAGACCCGAGTGA
CCCACTGCTTGTTTCTGTCACAGGTGAGGAAAGCCCATGCCTGTCCCATGTCCTGTGATCCTAGAGCCTTAGCTGAGGAG
CTTCCTGCTGATGATGGAGAGAAGCATGGACAGATGCAGAGAGAACACGCAGCATGGTGTGAGGGAGGGATCAGGGCACA
GGATGGCAGACAGGGCACCTCCAAACCCTCCTGCACGGCCTGCATGGAGGCCCGCGGCCAGGGCTCCAGGCACCCAGGCA
GATGGAGAAAGTGGTCAGGACAGACCCAGAGGAGGGAGACTCAGCTCAGTTTGGGGAGATCAGAGGCTCCCTCAGACCCT
AAACCTTACCCATTTCCCAGAAGCCCATACTGGCCTCTCACCCACACAGAGATGTCATCACCAGCAACCCCTACACCCTT
TTCTTTCCGTTTGAAAAAACATTTATTTAGGTTAAATGTAACTATATAATTTGCCACCTTTACCATTTTTAAAAGTAAAA
TCTAGTGGTCATAAATTCCTTTATATGCAGGGTGCAGTGGCTCACAGTTATAATCTCGGTGCTTTGAGAGGCCAAGGAAG
GTGGATCATTTAAGATCAGAGGCTCGAGATCAGCCTGGCCAACATGAGGGAAATTCATCTTTACTAAACAGACAAGAAAA
ATTGGCTGGGCATGCTGGCATGCACCTGTATTCCTAGCTACATGGGAGGCTGAGGCAGGAGAAGTACGTAAGCCCAGGAG
GCAGAGGTTGCACTGAGCTGAGATCAGGCCACTGCACTGCAGCCTGGGAGACAGAGAGAGATTCTGTCTCTAAATAAATA
AATACATCTATATTCTTTTTTATTGTTGTTGTTACACTCCACCCTTTACTTCCTGCCCTCTGGTAGCCACCATTCTACTC
TCTACCTTCATGAGATCCACCTTTTAGCTCCTGTATATGGGTGAGAAATGGGAATCTTTGCAATGACCTCCAGTTCCATC
CATGTGGCTGCAAATGTCAGGATGTTATTCTTTCTACGGATGAGTACTCTCCACTGTGTGTGTGTACTACATTCTCTCTA
TCCATTCACCCACTGACGGGCAGGTAAGTTGACTCCACATCTTGGCTACTGTGAACAGTGCTGCACCAATCGTATGAGTG
CAGATATCACTTCGATACACTGATGTCCTTCCCTTTGGGTTTACACCCAGTAGTGGAATTGCTAGATCCTATCAACAGGG
TACCAGGGTTCTCCTTTCTCTACCACCTTGCCAGCATTTATTTTGTCTGTGTTTCAGATAAAAGCCACTTTAATGGGATG
AGATGATAGCTCACTGTGATTTCAATTGGCATGATTAGTGATACTGAGCACTTTTTCATGTACATGTTCGCCATTTGTAC
GTTTTGTTTGTTGAGAAATGTCTGTTCAGGTCTTTTACTAATTGTTAAATTAAATTCATTGTTTTATACCGTTGCTTGAG
TTTTATGTATATTCTAGTTATTAATCCCCTCTCAGATGCATACTTCACAAATATTTTCTCCCAATTTGTCTCTTCTTCAC
TTTGTTGGTTGCTTCCTTTGCGGTGCAGAAGCTGCTTACTTTGATGTAATCCCGAAGGTCTATTATTTTGTTTTGATTTC
TTGTGTTTTTGAGATTTCAAATAAAATGTCTTTCCTCAGACAAATGTCCTGGAGCATTTCCCCACTCTTTCCTTTTAGAC
GCTTAATGGTTTCAGGCCTTAAGTGTTTCTTCCATTTTCATTTGATTTCTGTGTATGGTGAGAGGTCGAGGTGCAGTTTC
ATCAACTGCATGTAGATACCAGTTTTCCCTGCTCCATTTATTGAAAAGACCGTCGTTTCCTGATTGCAGGTTCTTGGCAC
GTACAATCGTCAAAGTCCATTGGATGTGAATGCATGAATTATATCTGTGTTCTTCATTCTGCTCCATTGCTCTAAGGGCC
TTTATGCCAATGTCATGCTGTTGTGCTTACTACAGCTTTGTAACATATTTTTAAGTCAGGGAGTGTGAGGCCTCCAGCAC
CTGTTTTGTCTTTATACCTCGAAATCTCAGGACACTGGGCATCATTTAACAATGATGATGGAGAAGGGGACGCCAGGACT
CCTAGGGCCCAACATTAGATAACAGAGTGTTGGCCATGAACCAACCTCAAAGATTTCCTTTGAGTAGAAGACAGGCATCC
TCATTTCCTCACCTCTCTCCTGTCCTGTGTTCTAGGAAACTCTTCAAGTAGTTCATCTTCACCCACTGAACCAAGCTCCA
AAACTGGTGAGTAAAGATCCCTCTTATCTCTGCTTTTGGAAACCTGGGGAGGTTGGTATCTTGGATTCAAGCATTGGCTC
AGCACCTCCCAGCTCTGTGATTGTGGGCCTGTCTTCTAACATCTCTGACCCCCAGACACTACAACAGCGAAGGGTATCTG
AGGACAGCAAAGGGCTCAGTGAAGTCTCTTCATTTCAAATTTCTGCAGCTGAGACCTCCTCCAAGCTAGACGGACGAGTA
CAAATCTGACATCCTTCTCAGGGATAAAGTGGTGTTTTTTCTGCCTGCATTCCAAATTGGAGGATAAATTTGAGGGGACT
TGAGAGAGGGAGGGGAAGGGAACATCTGATGAGGGAAAGGTGATTTAGAGAAGTTCCACTTGCCAAGGAATGAGCCCCTG
TTGGTCATGATGCGACCTTGGCTGAGTCAGCAGAGCAAGAGCCTTGCAGTAAGAAGGAACGTAGTTCATCCACAAATATG
ACACTTCCACTTACTCACTTATTCAGCCACTGCCCTGTGCTCTGACTGTACAGTGTGGAACCCTTTCCTGCTGTTGCCAT
AATAAATCTCCACAAACTTCATGGATGACAACAACACAGCTTTTAAAATTATCTTACAGTGTTATAGCTCAGAAATATGA
AATGCATTTCACTGGGCTAAAATCAAGGTGACTGCGAGGCTGCCTTTTCTCTGAAGGTTCCAGGCGAGAATCGGCTTTTC
ACATTTCCCAGCTCCCAGAGGTTCCCACGTTCCTTGGCATCTGGTCCCCATCCTCCTTCCTCGAAGCCCACAAAAGCTCA
TCACATCTCTCACGTGGCATCACTCAGATCCCTCTTCCTTACCTCACCTCTTTCTCTAAGTGTTGCTCTGACTTTTTCTT
CCTCTTTTAAAGACTTTGGGATTCTATTGAGTTTACCAAGATAATCCATCACAATCTCCCTAAAATCACCCAAGATAACC
TCTTTTTAAGTTCAGCTGATTAGCAACCATAATTCCATCTGCAATCTTTATTCCTCCTTTCATGTAAAATAACATATTCA
CAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGGTGGGCCAGCATTCTCCTGCCTTCCACAAATGGTAAACACGATGC
ATTTGGCCTCTGCTCTTAGGACACTGACATTGCAGATGGGCAAATGGGAGGGCAGAATATGAATGCACAAGTGGACCAGT
AATGATTGATCCATTGGGAAGCATCCGTGCATGAAATCTATTTACCTATTTATTTATCTATTTATCTATTTATGTATTTA
TTTATTTGCGGCGAAGTCATTCTCTGTCCCCGGGCTGGAGTGCAGTGGCATGACCTCAGCTCACCACAACCTCCGCCTCC
CGGGTTCAGGCGATTCTCCTGCCTCAGCCTCCTGACTAGTTGTGATTCCAGTCCCCTCCACCACACCCAGCTAATATTCT
TTTATATTTTTTAGTAGAGATGGAGTTTCACCATGTTGCGCAGATTGTCTCCAACTCCCAACCTCAAGTGATCCGACCGT
CTCAGCATCCCAAAATGCTGGGACTCAAGGTGTGAGACACTGCGCCCAGCCGAAATTTAAAATAAATAATAAAGAATTCT
AAGTGTATAATTTCAGGAGACAGAGAAAGTCTCACTAATCAGATAATATTTGTGACCATAATGAAAAAAAAAAGTAGATT
CAACCCCTGGAAGATTGGCGGAAGGATTTTCCACACACAGCTGTCAGCCGTGAAGGCACAAATGTGAAAACAATCTGATG
TGGAAGGAAGAGGCTCTGCATTCAAATGCTGGGAATGACGTGGGGAGAATGACAAGACGACTGTGGAGAGACGGAGAGCA
CTCTGGGTACACAGGAAACTAAGGAGGAACAAGGAGCGTGTGTTTGACACTCACAGCCATTGGATTCACCTCGGGGTAGC
CAGGAATCCCTACATGATTAATATGACTGACATGAAAATAAGGACGCCCAAGTGCGTAACTGGAATCTAGGAGACCGTGG
AAAAGGCAATTCCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGATGGGTATAAGATAT
GTCTGTGAGGTAGAATCATTTGTAGGGAGGGCTTGCTGGATTTGATAATGCCTACTTATTTAATTTTGAATATATTAATT
TCTTTCTGAGATTTATTTTTCCTACATGTAAATCAATATCTGGCAGAGGAGTGATTGATAGATAGATGAGGGGTGGTGCA
AATGAAGGGACTTATTATAGCATAATATACAAGTCTGTGAATGGGAGCTTACGCCTGTAACCCAACACTTTGGGAGGCCA
AGGCGTTTGGATCACTTGAGGTCAGGAGTTTGAGACCAGCCTGGCCAACATGGAGAAACCCCATGCTCTTTTTAGCAACC
AGTCCTAGGGACCTCATGGAGAACTTGCCAACCACGTCTCATGGGGACAGCATTAATGTATTCATGATGGATCCACCCCC
ATAACTGGAACGTCTCTCAATAGGCCCAGCCTCCCACACTGCGAGATAAGTGTCAACGTGAGGTTTGGCGGGGTCAAACA
TCCAAACTATAGCAGTGGTATCCCCAGCATGTTCTCTGATTATTTTGAGAACTATAACTGAGAAAGCAGGAGAAAGCTGG
GTATCCTGCCATCGGGGAACTTGTCCTAAACAGATGTTGTATGTGCTTAGCTGGCAACCAAGAAATGAGAGACAATCCAT
AAAGAGGAACTGCTATAATTAGCTTCTTATTGGATTCCCACCTTCCCCCAGGTATCCGCAGACACCTGCACATTCTGATT
GGGACCTCAGTGGCTATCATCCTCTTCATCATCCTCTTCTTCTTTCTCCTTCATTGCTGCTGCTCCAACAAAAAGAGTAA
GTCTCACGAAGCAGAGGTCAGAGAGCTCAGGACCATGTGGGGAAGCAGGATGGGAGCACACTGGTGTGTGTTCCTGACTG
GCAGGATGGTCCCTGGACCAAGGCAGGAGCCACAGAGGCAGGGCTTTCTAGAGAGAGCACCAGACACCCTGCCCCTGCCT
TCAGCTCACAGACCATTGCCTGATTCTGAACTGTATCCTCACGTCCCCTGCAGCCACTGACATCCAGGAGAAGGTTCCAT
GACAGGCAGAAAGGGGAGACAGAATCACTGGGATGGGAACTCAGAGCTATTCATGGGATGGGTCCTTGAGCTCAGAGAGA
TAGAATGTCTGGGTCTGGCTGATGACAGCTGAGGGACCTCAGGCACCTACGGCCTCCCGCTGTGTGTTGGTGTCTGCTCA
TGAAATGAGGACCCAAAAGTGCCCTTCCAGCTGTTTTGATGACTTCTATCTCCTACAGATGCTGCTGTAATGGACCAAGA
GCCTGCCGGGGACAGAACAGTGAACAGGGAGGTAGGTTCTCCTCAGCCCAGCCTCATGGATTGAGTCTCATTCCCTAATA
GTCTTGAAGAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGACTCTGATGATCAAGACCCTCAGGAGGT
GACATATGCACAGTTGGATCACTGCGTTTTCACACAGACAAAAATCACTTCCCCTTCTCAGAGGCCCAAGACACCTCCAA
CAGATACCACCATGTACATGGAACTTCCAAATGCTAAGCCAAGATCATTGTCTCCTGCCCATAAGCACCACAGTCAGGCC
TTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCTAGCTCCCATGTACCAGCAGCTGGAATCTG
AAGGCATCAGTCTTCATCTTAGGGGATCGCTCTTCCTCACACCACAAATCTGAACATGCCTCTCTCTTGCTTACAAATGT
CTAAGGTCCCCACTGCCTGCTGGAGAGAAGACACACTCCTTTGCTTAGCCCACAATTCTCTATTTCACTTGACCCCTGCC
CACCTCTCCAACTGAACTGGCTTACTTCCTAGTCTACTTGAGGCTGCAATCACACTGAGGAACTCACAATTCCAGACATA
CAAGAGGCTCCCTCTTAACATGGCACTGAGACACGTGCTGTTCCACCTTCCCTCATGCTGTTTCACCTTTCCTCAGACTA
TTTTCCAGCCTTCTGTCAGTCAGCAGTGAAACTTATAAAATTTTTTGTGATTTCAATGTAGCTGTCTCCTTTTCAAATAA
ACATGTCTGCCCTCAT

IPD-KIR