Allele Report for 2DL5B*0020103


2DL5B*0020103
Previous Designations & Local Names: None
IPD Acc No: KIR00301
Assigned: 12-DEC-2007 Sequence Last Modified: 18-JAN-2008
Source Entries: AY320039  
Cells Sequence Derived From: WT47  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
Protein Sequence (375 aa)
MSLMVVSMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSI
LMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGR
AHEPRLPAVPSVDGTFQADFPLGPATHGGTYTCFSSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH
ILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKT
PPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI
Nucleotide Sequence Data (1128 bps)
ATGTCGCTCATGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGACACATGAGGGTGGACAGGA
CAAGCCCTTGCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACATGTGACTCTTCTGTGTCGCTCTCGTCTTG
GGTTTACCATCTTCAGTCTGTACAAAGAAGATGGGGTGCCTGTCCCTGAGCTCTACAACAAAATATTCTGGAAGAGCATC
CTCATGGGCCCTGTGACCCCTGCACACGCAGGGACCTACAGATGTCGGGGTTCACACCCGCGCTCCCCCATTGAGTGGTC
GGCACCCAGCAACCCCCTGGTGATCGTGGTCACAGGTCTATTTGGGAAACCTTCACTCTCAGCCCAGCCGGGCCCCACGG
TTCGCACAGGAGAGAACGTGACCTTGTCCTGCAGCTCCAGGAGCTCATTTGACATGTACCATCTATCCAGGGAGGGGAGG
GCCCATGAACCTAGGCTCCCTGCAGTGCCCAGCGTCGATGGAACATTCCAGGCTGACTTTCCTCTGGGCCCTGCCACCCA
CGGAGGGACCTACACATGCTTCAGCTCTCTCCATGACTCACCCTATGAGTGGTCAGACCCGAGTGACCCACTGCTTGTTT
CTGTCACAGGAAACTCTTCAAGTAGTTCATCTTCACCCACTGAACCAAGCTCCAAAACTGGTATCCGCAGACACCTGCAC
ATTCTGATTGGGACCTCAGTGGCTATCATCCTCTTCATCATCCTCTTCTTCTTTCTCCTTCATTGCTGCTGCTCCAACAA
AAAGAATGCTGCTGTAATGGACCAAGAGCCTGCCGGGGACAGAACAGTGAACAGGGAGGACTCTGATGATCAAGACCCTC
AGGAGGTGACATATGCACAGTTGGATCACTGCGTTTTCACACAGACAAAAATCACTTCCCCTTCTCAGAGGCCCAAGACA
CCTCCAACAGATACCACCATGTACATGGAACTTCCAAATGCTAAGCCAAGATCATTGTCTCCTGCCCATAAGCACCACAG
TCAGGCCTTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCTAGCTCCCATGTACCAGCAGCTG
GAATCTGA
Genomic Sequence Data (9850 bps)
CTTCCCTGGGAATTTAAATCATTTTAGCTGGTTCTGCTGTAATACTAGAAATACAAGCATGAAAAATTCTAATGGTTTAT
TAGTCACAATGACTCCGAAAACATTAATAATACCTATTAGATACTTTGCATATTACACAGGAAGAAGAGTTTGAATCTCA
GATAAAAACAAAAAAAATACATGAAAAGTCTTTCATGTTAGCACAGATTTTAGGCATCTCGTGTTCGGATAAAAATACAT
GAAAAGTCTTTCACGTTAGCACAGATTTTAGGCATCTTGTGTTCGGGAGGTTGGATCTGAGACGTGTTGTGAGTTGGTCA
TAGTGAAGGACGTGAGGTGCCAATTCTAGTGAGAACAATTTCCAGGAAGCCGTGTTCCGCTCTTGAGCAAGCATCCACTG
GGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCCTCCCATGATGTAGTCAACATGTAAGCTGCATGGGCAGGGCG
CCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCGCGGCTGCCTGTCTGCACCGGCAGCACCATGTCGCTCATGG
TCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAAGGAATAGAGGGAGGGAGCGCGGGGATGGAGATCTGGGCCCAGAGG
TGGAGATATAGGCCTGGAGGTGGAGTTATGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGATATATGGGCCTGGAGATG
GAGTGATGGGCCTAGAAGTGGAGATCTGGGTCTGGAGTGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGA
GATCTGGGCCTGGAGTGGAGATAGGAACCTGGAGGGGAGATATGAGCCTGGAGTGAAGATATTGGCCTGGGATGGAGATA
TGGGCCTGGAGTGGAGACATGGGCCTGGAGGTGGAGATATGGGCCTGGAGGTGGAGACATGGGCCTAGAGGTGGATATCT
GGGCCTGGAGTGGACATATGGGCCTAGGATGGAGATATGGGCCTGGGTGTGGAGATATGGGCTTGGGGTGGAGATATGGG
CCTGGATTGGAGATATGGGTCTAGGGTGGAAATATTGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCTTG
GGGTGGGGATAGGGGCCTGGGGTGCGGATATGGGCCTGCAGGCTGGGTCTCTACACAGCCGACAGCCCTGTTCTTGGGTG
CAGGCTGGCACTGAGGGTGAGTTTCCCTTCAGCCCAGCAAGGGCCTGGCTACCAAGACTCACAGCCCAGTGGGGGCAGCA
AGGGAGTCCTGGTTTGCCTGCAGATGGATGGTCCATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCTGG
ACACATGAGGGTGAGTCCTTCTCCAAACCTTCGGGTGTCATCTCCCCACATAAGAGGATTTTCCTGAAACAGGAGGGAAG
CCCGGTGGGGGATTTTCTTATAAACAAGGATGAGGAGACCCTGGGGTGCTCAGCCCACAGTTCCGACCTTGCCCTCCCCA
GCCTTCCTTTCCCTTGGCTGAGTCAGGTTCTGTGGGAACCCGGGAGGGTAGACTGGGGTCCTCCAAGCTGGGCTGTGCGG
CTGGGATGTGGTGTCACTGGCAGAGGAAGGGAGCAAAGCAGTGCTAGGAACAGCAGGCCTCTGAGGACAAAGGTGTAACT
CACACCCTCCAGCGTTTCCATGACGGTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCTCAGAGGTGGGGGAACCCCAG
CCAGGGCCCTGACCTTCCAAATCCTCTGTTGGGGGCTCAGTTGTGTATTGTGGTTCACACATTGGCTGATATTCCATTCA
CAAAGAACATGCCCTCGACCCCATGTCTATTTGTGTTGTTTTATGTGAGTAATCTTGCAGTATTAAAATCTAGTAGGAGT
CCCTTACTCAGCACTTGCTCAAAGTTCTCAGCTGACACTTTTGTTGTAGAGAGACGCCAAGTCTATGCGGGGTGGGTCCT
TCCCGTAGCCATGGGCACCCAAGTGTGGTAGGAGCCTTAGAAACGAGGAAAGTGGGGAGAATCTTCTGAGCACTGGCAGG
GAGGGGCGGCTCCACATCCTCCTTTCTAAGGTGGCGCCTCCTTCTCCCCCAGGTGGACAGGACAAGCCCTTGCTGTCTGC
CTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACATGTGACTCTTCTGTGTCGCTCTCGTCTTGGGTTTACCATCTTCAGTC
TGTACAAAGAAGATGGGGTGCCTGTCCCTGAGCTCTACAACAAAATATTCTGGAAGAGCATCCTCATGGGCCCTGTGACC
CCTGCACACGCAGGGACCTACAGATGTCGGGGTTCACACCCGCGCTCCCCCATTGAGTGGTCGGCACCCAGCAACCCCCT
GGTGATCGTGGTCACAGGTCAGAGGACTCATGTCTGGGCTTCTCCTTCTCCCACTTCCTGAATCCCAGAGCATCTGGTGG
GGGTGTCCACCAGGGTCCAATCATCCAGGCCCTGACTGTATTTGGTGTCAATGGGGATTGAATACAGGGGAATGGGTGCT
GTGGTGGAAAGAGTAACTGTCGGCAGCATGGCTATATTGTAATCCTTGGAGCCTGTGACTATTTATGTTATAGGACATGG
GACTGAAGGGGAAGATGGAGTTCAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGACGACCTGGACTCTCCCACTGGGC
TCAGTGTAATCACAAGGGTCCACATGAGAGGAGGAGGAAGAGGAGAGTGGGGATTAGAGCAGCGTAGTGGGAGGGAGAGT
CCACCAGCCACTGCGGGCTTTGAAAGTGGAGGAAGGCCAGAAGCCACGGAATGCAGGTGGCCTTTAGGGGCTGGAGAAGT
CAATGGAACTGATTCTCCCGAGTCTCCAGAGGGAATGCAGCCCTGCAGATGCCTTGATTGTAGCCCAGGAAGAACAGGGT
CTGATTTCTGTCAACAGAAGTGTTCTCTCCCGCCGCCGTGTTTGTGATAATTTTCTGCAGCAACAACAGGAAACAACACA
GGAATCCAGGTCAAGGACAAGTTAAAAAACCAAACAAGAGGGTTGGCTACCCTAAGGTCAGCAAGGGTGCACTGCTGATG
CCACCACCAGGCTGGAGCTGCATAGGGAGGGATCCACAGGGAGAGTCGGGGGTGGAGGGTGAGAGAGAGAGAGAGCATTA
GGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTGTGAGGGGAGCTGTGACAAGGAAGAACCTCCCTGAGGAAACTGC
CTCTTCTTCCAGGTCTATTTGGGAAACCTTCACTCTCAGCCCAGCCGGGCCCCACGGTTCGCACAGGAGAGAACGTGACC
TTGTCCTGCAGCTCCAGGAGCTCATTTGACATGTACCATCTATCCAGGGAGGGGAGGGCCCATGAACCTAGGCTCCCTGC
AGTGCCCAGCGTCGATGGAACATTCCAGGCTGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACACATGCTTCA
GCTCTCTCCATGACTCACCCTATGAGTGGTCAGACCCGAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAGCCCA
TGCCTGTCCCATGTCCTGTGATCCTAGAGCCTTAGCTGAGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGACAGATGC
AGAGAGAACACGCAGCATGGTGTGAGGGAGGGATCAGGGCACAGGATGGCAGACAGGGCACCTCCAAACCCTCCTGCACG
GCCTGCATGGAGGCCCGCGGCCAGGGCTCCAGGCACCCAGGCAGATGGAGAAAGTGGTCAGGACAGACCCAGAGGAGGGA
GACTCGGCTCAGTTTGGGGAGATCAGAGGCTCCTCAGACCCTCAACCTTACCCATTTCCCAGAAGCCCATACTGGCCTCT
CACCCACACAGAGATGTCATCACCAGCAACCCCTACACCCTTTTCTTTCCGTTTGAAAAAACATTTATTGAGGTTAAATG
TAACTATATAATTTGCCACCTTTACCATTTTTAAAAGTAAAATCTAGTGGTCATAAATTCCTTTATATGCAGGGTGCAGT
GGCTCACAGTTATAATCTCGGTGCTTTGAGAGGCCAAGGAAGGTGGATCATTTAAGATCAGAGGCTCGAGATCAGCCTGG
CCAACATGAGGGAAATTCATCTTTACTAAACAGACAAGAAAAATTGGCTGGGCATGCTGGCATGCACCTGTATTCCTAGC
TACATGGGAGGCTGAGGCAGGAGAAGTACGTAAGCCCAGGAGGCAGAGGTTGCACTGAGCTGAGATCAGGCCACTGCACT
GCAGCCTGGGAGACAGAGAGAGATTCTGTCTCTAAATAAATAAATACATCTATATTCTTTTTTATTGTTGTTGTTACACT
CCACCCTTTACTTCCTGCCCTCTGGTAGCCACCATTCTACTCTCTACCTTCATGAGATCCACCTTTTAGCTCCTGTATAT
GGGTGAGAAATGGGAATCTTTGCAATGACCTCCAGTTCCATCCATGTGGCTGCAAATGTCAGGATGTTATTCTTTCTACG
GATGAGTACTCTCCACTGTGTGTGTGTACTACATTCTCTCTATCCATTCACCCACTGACGGGCAGGTAAGTTGACTCCAC
ATCTTGGCTACTGTGAACAGTGCTGCACCAATCGTATGAGTGCAGATATCACTTCGATACACTGATGTCCTTCCCTTTGG
GTTTACACCCAGTAGTGGAATTGCTAGATCCTATCAACAGGGTACCAGGGTTCTCCTTTCTCTACCACCTTGCCAGCATT
CATTTTGTCTGTGTTTCAGATAAAAGCCACTTTAATGGGATGAGATGATAGCTCACTGTGATTTCAATTGGCATGATTAG
TGATACTGAGCACTTTTTCATGTACATGTTCGCCATTTGTACGTTTTGTTTGTTGAGAAATGTCTGTTCAGGTCTTTTAC
TAATTGTTAAATTAAATTCATTGTTTTATACCGTTGCTTGAGTTTTATGTATATTCTAGTTATTAATCCCCTCTCAGATG
CATACTTCACAAATATTTTCTCCCAATTTGTCTCTTCTTCACTTTGTTGGTTGCTTCCTTTGCGGTGCAGAAGCTGCTTA
CTTTGATGTAATCCCGAAGGTCTATTATTTTGTTTTGATTTCTTGTGTTTTTGAGATTTCAAATAAAATGTCTTTCCTCA
GACAAATGTCCTGGAGCATTTCCCCACTCTTTCCTTTTAGACGCTTAATGGTTTCAGGCCTTAAGTGTTTCTTCCATTTT
CATTTGATTTCTGTGTATGGTGAGAGGTAGAGGTGCAGTTTCATCAACTGCATGTAGATACCAGTTTTCCCTGCTCCATT
TATTGAAAAGACCGTCGTTTCCTGATTGCAGGTTCTTGGCACCTACAATCGTCAAAGTCCATTGGATGTGAATGCATGAA
TTATATCTGTGTTCTTCATTCTGCTCCATTGCTCTAAGGGCCTTTATGCCAATGTCATGCTGTTGTGCTTACTACAGCTT
TGTAACATATTTTTAAGTCAGGGAGTGTGAGGCCTCCAGCACCTGTTTTGTCTTTATACCTCGAAATCTCAGGACACTGG
GCATCATTTAACAATGATGATGGAGAAGGGGACGCCAGGACTCCTAGGGCCCAACATTAGATAACAGAGTGTTGGCCATG
AACCAACCTCAAAGATTTCCTTTGAGTAGAAGACAGGCATCCTCATTTCCTCACCTCTCTCCTGTCCTGTGTTCTAGGAA
ACTCTTCAAGTAGTTCATCTTCACCCACTGAACCAAGCTCCAAAACTGGTGAGTAAAGATCCCTCTTATCTCTGCTTTTG
GAAACCTGGGGAGGTTGGTATCTTGGATTCAAGCATTGGCTCAGCACCTCCCAGCTCTGTGATTGTGGGCCTGTCTTCTA
ACATCTCTGACCCCCAGACACTACAACAGCGAAGGGTATCTGAGGACAGCAAAGGGCTCAGTGAAGTCTCTTCATTTCAA
ATTTCTGCAGCTGAGACCTCCTCCAAGCTAGACGGACGAGTACAAATCTGACATCCTTCTCAGGGATAATGTGGTGTTTT
TTCTGCCTGCATTCCAAATTGGAGGATAAATTCGAGGGGACTTGAGAGAGGGAGGGGAAGGGAACATCTGATGAGGGAAA
GGTGATTTAGAGAAGTTCCACTTGCCAAGGAATGAGCCCCTGTTGGTCATGATGCGACCTTGGCTGAGTCAGCAGAGCAA
GAGCCTTGCAGTAAGAAGGAACGTAGTTCATCCACGAATATGACACTTCCACTCACTCACTTATTCAGCCACTGCCCTGT
GCTCTGACTGTACAGTGTGGAACCCTTTCCTGCTGTTGCCATAATAAATCTCCACAAACTTCATGGATGACAACAACACA
GCTTTTAAAATTATCTTACAGTGTTATAGCTCAGAAATATGAAATGCATTTCACTGGGCTAAAATCAAGGTGACTGCGAG
GCTGCCTTTTCTCTGAAGGTTCCAGGCGAGAATCGGCTTTTCACATTTCCCAGCTCCCAGAGGTTCCCACGTTCCTTGGC
ATCTGGTCCCCATCCTCCTTCCTCGAAGTCCACAAAAGCTCGTCACATCTCTCACGTGGCATCACTCAGATCCCTCTTCC
TTACCTCACCTCTTTCTCTAAGTGTTGCTCTGACTTTTTCTTCCTCTTTTAAAGACTTTGGGATTCTATTGAGTTTACCA
AGATAATCCATCACAATCTCCCTAAAATCACCCAAGATAACCTCTTTTTAAGTTCAGCTGATTAGCAACCATAATTCCAT
CTGCAATCTTTATTCCTCCTTTCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGGTG
GGCCAGCATTCTCCTGCCTTCCACAAATGGTAAACACGATGCATTTGGCCTCTGCTCTTAGGACACTGACATTGCAGATG
GGCAAATGGGAGGGCAGAATATGAATGCACAAGTGGACCAGTAATGATTGATCCATTGGGAAGCATCCGTGCATGAAATC
TATTTACCTATTTATTTATCTATTTATCTATTTATGTATTTATTTATTTGCGGCGAAGTCATTCTCTGTCCCCGGGCTGG
AGTGCAGTGGCATGACCTCAGCTCACCACAACCTCCGCCTCCCGGGTTCAGGCGATTCTCCTGCCTCAGCCTCCTGACTA
GTTGTGATTCCAGTCCCCTCCACCACACCCAGCTAATTTTCTTTTATATTTTTTAGTAGAGATGGAGTTTCACCATGTTG
CGCAGATTGTCTCCAACTCCCAACCTCAAGTGATCCGACCGTCTCAGCATCCCAAAATGCTGGGACTCAAGGCGTGAGCC
ACTGCGCCCAGCCGAAATTTAAAATAAATAATAAAGAATTCTAAGTGTATAATTTCAGGAGACAGAGAAAGTCTCACTAA
TCAGATAATATTTGTGACCATAATGAAAAAAAAAAGTAGATTCAACCCCTGGAAGATGGGCGGAAGGATTTTCCACACAC
AGCTGTCAGCCGTGAAGGCACAAATGTGAAAACAATCTGATGTGGAAGGAAGAGGCTCTGCATTCAAATGCTGGGAATGA
CGTGGGGAGAATGACAAGATGACTGTAGGGAGACGGAGAGCACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGCG
TGTGTTTGACACTCACAGCCATTGGATTCACCTCGGGGTAACCAGGAATCCCTACATGATTAATATGACTGACATGAAAA
TAAGGGACGCCCAAGTGCGTAACTGGAATCTAGGAGACCGTGGAAAAGGCAATTCCCGCCCCACTGGTGAAATGTGGTGC
TGATTTAGACACTAAATGAATGAAGTAGATGGGTATAAGATATGTCTGTGAGGTAGAATCATTTGTAGGGAGGGCTTGCT
GGATTTGATAATGCCTACTTATTTAATTTTGAATATATTAATTTCTTTCTGAGATTTATTTTTCCTACATGTAAATCAAT
ATCTGGCAGAGGAGTGATAGATAGATGAGGGGTGGTGCAAATGAAGGGACTTATTATAGCATAATATACAAGTCTGTGAA
TGGGAGCTTACGCCTGTAACCCAACACTTTGGGAGGCCAAGGCGTTTGGATCACTTGAGGTCAGGAGTTTGAGACCAGCC
TGGCCAACATGGAGAAACCCCATGCTCTTTTTAGCAACCAGTCCTAGGGACCTCATGGAGAACTTGCCAACCACGTCTCA
TGGGGACAGCATTAATGTATTCATGATGGATCCACCCCCATAACTGGAACGTCTCTCAATAGGCCCAGCCTCCCACACTG
CGAGATAAGTGTCAACGTGAGGTTTGGCGGGGTCAAACATCCAAACTATAGCAGTGGTATCCCCAGCATGTTCTCTGATT
ATTTTGAGAACTATAACTGAGAAAGCAGGAGAAAGCTGGGTATCCTGCCATCGGGGAACTTGTCCTAAACAGATGTTGTA
TGTGCTTAGCTGGCAACCAAGAAATGAGAGACAATCCATAAAGAGGAACTGCTATAATTAGCTTCTTATTGGATTCCCAC
CTTCCCCCAGGTATCCGCAGACACCTGCACATTCTGATTGGGACCTCAGTGGCTATCATCCTCTTCATCATCCTCTTCTT
CTTTCTCCTTCATTGCTGCTGCTCCAACAAAAAGAGTAAGTCTCACGAAGCAGAGGTCAGAGAGCTCAGGACCATGTGGG
GAAGCAGGATGGGAGCACACTGGTGTGTGTTCCTGACTGGCAGGATGGTCCCTGGACCAAGGCAGGAGCCACAGAGGCAG
GGCTTTCTAGAGAGAGCACCAGACACCCTGCCCCTGCCTTCAGCTCACAGACCATTGCCTGATTCTGAACTGTATCCTCA
CGTCCCCTGCAGCCACTGACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGGGGAGACAGAATCACTGGGATGGGAACT
CAGAGCTATTCATGGGATGGGTCCTTGAGCTCAGAGAGATAGAATGTCTGGGTCTGGCTGATGACAGCTGAGGGACCTCA
GGCACCTACGGCCTCCCGCTGTGTGTTGGTGTCTGCTCATGAAATGAGGACCCAAAAGTGCCCTTCCAGCTGTTTTGATG
ACTTCTATCTCCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCCGGGGACAGAACAGTGAACAGGGAGGTAGGTTCTC
CTCAGCCCAGCCTCATGGATTGAGTCTCATTCCCTAATAGTCTTGAAGAATGTGAGCACCCTCCCTCACTCAGCATTTCC
CTCTCTCCAGGACTCTGATGATCAAGACCCTCAGGAGGTGACATATGCACAGTTGGATCACTGCGTTTTCACACAGACAA
AAATCACTTCCCCTTCTCAGAGGCCCAAGACACCTCCAACAGATACCACCATGTACATGGAACTTCCAAATGCTAAGCCA
AGATCATTGTCTCCTGCCCATAAGCACCACAGTCAGGCCTTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAA
CCGGGTTGCTAGCTCCCATGTACCAGCAGCTGGAATCTGAAGGCATCAGTCTTCATCTTAGGGGATCGCTCTTCCTCACA
CCACAAATCTGAACATGCCTCTCTCTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAGAAGACACACACCTT
TGCTTAGCCCACAATTCTCTATTTCACTTGACCCCTGCCCACCTCTCCAACTGAACTGGCTTACTTCCTAGTCTACTTGA
GGCTGCAATCACACTGAGGAACTCACAATTCCAGACATACAAGAGGCTCCCTCTTAACATGGCACTGAGACACGTGCTGT
TCCACCTTCC

IPD-KIR