Allele Report for 2DL5A*0010101


2DL5A*0010101
Previous Designations & Local Names: 2DL5.1, 2DL5.2
IPD Acc No: KIR00029
Assigned: 28-JUN-2003 Sequence Last Modified: 24-JAN-2005
Source Entries: AF204903 , AF217485 , AL133414 , CU459006 , EU031916  
Cells Sequence Derived From: COX , NV , RDP1 , RPCI-1  
Known Ethnic Origin Of Source: Caucasoid
Publications
Vilches C et al. J Immunol 165:6416-21 2000. abstract
Vilches C et al. J Immunol 164:5797-804 2000. abstract
Mulrooney TJ et al. Immunogenetics 60:287-294 2008. abstract
Wilson MJ et al. Proc Natl Acad Sci U S A 97:4778-83 2000. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 4 Laboratories: 4
Protein Sequence (375 aa)
MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSI
LMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGR
AHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH
ILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKT
PPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTALSQNRVASSHVPAAGI
Nucleotide Sequence Data (1128 bps)
ATGTCGCTCATGGTCATCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGACACATGAGGGTGGTCAGGA
CAAGCCCTTGCTGTCTGCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACATGTGACTCTTCTGTGTCGCTCTCGTCTTG
GGTTTACCATCTTCAGTCTGTACAAAGAAGATGGGGTGCCTGTCCCTGAGCTCTACAACAAAATATTCTGGAAGAGCATC
CTCATGGGCCCTGTGACCCCTGCACACGCAGGGACCTACAGATGTCGGGGTTCACACCCACGCTCCCCCATTGAGTGGTC
AGCACCCAGCAACCCCCTGGTGATCGTGGTCACAGGTCTATTTGGGAAACCTTCACTCTCAGCCCAGCCGGGCCCCACGG
TTCGCACAGGAGAGAACGTGACCTTGTCCTGCAGCTCCAGGAGCTCATTTGACATGTACCATCTATCCAGGGAGGGGAGG
GCCCATGAACCTAGGCTCCCTGCAGTGCCCAGCGTCAATGGAACATTCCAGGCTGACTTTCCTCTGGGCCCTGCCACCCA
CGGAGGGACCTACACATGCTTCGGCTCTCTCCATGACTCACCCTATGAGTGGTCAGACCCGAGTGACCCACTGCTTGTTT
CTGTCACAGGAAACTCTTCAAGTAGTTCATCTTCACCCACTGAACCAAGCTCCAAAACTGGTATCCGCAGACACCTGCAC
ATTCTGATTGGGACCTCAGTGGCTATCATCCTCTTCATCATCCTCTTCTTCTTTCTCCTTCATTGCTGCTGCTCCAACAA
AAAGAATGCTGCTGTAATGGACCAAGAGCCTGCCGGGGACAGAACAGTGAACAGGGAGGACTCTGATGATCAAGACCCTC
AGGAGGTGACATATGCACAGTTGGATCACTGCGTTTTCACACAGACAAAAATCACTTCCCCTTCTCAGAGGCCCAAGACA
CCTCCAACAGATACCACCATGTACATGGAACTTCCAAATGCTAAGCCAAGATCATTGTCTCCTGCCCATAAGCACCACAG
TCAGGCCTTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCTAGCTCCCATGTACCAGCAGCTG
GAATCTGA
Genomic Sequence Data (9901 bps)
CTTCCCTGGGAATTTAAATCATTTTAGCTGGTTCTGCTGTAATACTAGAAATACAAGCATGAAAAATTCTAATGGTTTAT
TAGTCACAATGACTCCGAAAACATTAATAATACCTATTAGATACTTTGCATATTACACAGGAAGAAGAGTTTGAATCTCA
GATAAAAACAATAAAAATACATGAAAAGTCTTTCACGTTAGCACAGATTTTAGGCATCTTGTGTTCGGGAGGTTGGATCT
GAGACGTGTTGTGAGTTGGTCATAGTGAAGGACGCGAGGTGCCAATTCTAGTGAGAACAATTTCCAGGAAGCCGTGTTCC
GCTCTTGAGCAAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCCTCCCGTGATGTGGTCAACA
TGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTGGGGCGCGGCCGCCTGTCTGCACC
GGCAGCACCATGTCGCTCATGGTCATCAGCATGGCGTGTGTTGGTGAGTCCTGGAAAGGAATAGAGGGAGGGAGTGCGGG
GATGGAGATCTGGGCCCAGAGGTGGAGATATAGGCCTGGAGGTGGAGTTATGGGCCTGGAGTGGAGATCTGGGCCTGGAG
TGGATATATGGGCCTGGAGATGGAGTGATGGGCCTAGAAGTGGAGATCTGGGTCTGGAGTGGAGATATGGGCCTGGAGGT
GGAGATATGGGCCTGGAGTGGAGATCTGGGCCTGGAGTGGAGATAGGAACCCGGAGGGGAGATAGGAGCCTGGAGTGAAG
ATATTGGCCTGGGATGGAGATATGGGCCTGGAGTGGAGACATGGGCCTGGAGGTGGAGATATGGGCCTGGAGGTGGAGAT
ATGGGCCTAGAGGTGGATATCTGGGCCTGGAGTGGACATATGGGCCTAGGATGGAGATATGGGCTTGGGGTGGAGATATG
GGCCTGGATTGGAGATATGGGTCTAGGGTGGAAATATTGGCCTGGAGTGGAGATATGGGCCTGGAGTGGAGATATGGGCT
TGGGGTGGGGATAGGGGCCTGGGGTGCGGATATGGGCCTGGAGGCTGGGTCTCTACACAGCCGACAGCCCTGTTCTTGGG
TGCAAGCAGGCACTGAGGGTGAGTTTCCCTTCAGCCCAGCAAGGGCCTGGCTACCAAGACTCACAGCCCAGTGGGGGCAG
CAAGGGAGTCCTGGTTTGCCTGCAGATGGATGGTCCATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTGCAGGGGGCCT
GGACACATGAGGGTGAGTCCTTCTCCAAACCTTCGGGTGTCATCTCCCCACATAAGAGGATTTTCCTGAAACAGGAGGGA
AGCCCGGTGGGGGATTTTCTTATAAACAAGGATGAGGAGACCCTGGGGTGCTCAGCCCACAGTTCCGACCTTGCCCTCCC
CAGCCTTCCTTTCCCTTGGCTGAGTCAGGTTCTGTGGGAACCCGGGAGGGTAGACTGGGGTCCTCCAAGCTGGGCTGTGC
GGCTGGGATGTGGTGTCACTGGCAGAGGAAGGGAGCAAAGCAGTGCTAGGAACAGCAGGCCTCTGAGGACAAAGGTGTAA
CTCACACCCTCCAGCGTTTCCATGACGGTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCTCAGAGGTGGGGGAACCCC
AGCCAGGGCCCTGACCTTCCAAATCCTCTGTTGGGGGCTCAGTTGTGTATTGTGGTTCACACATTGGCTGATATTCCATT
CACAAAGAACATGCCCTCGACCCCATGTCTATTTGTGTTGTTTTATGTGAGTAATCTTGCAGTATTAAAATCTAGTAGGA
GTCCCTTACTCAGCACTTGCTCAAAGTTCTCAGCTGACACTTTTGTTGTAGAGAGACGCCAAGTCTATGCGGGGTGGGTC
CTTCCCGTACCCATGGGCACCCAAGTGTGGTAGGAGCCTTAGAAACGAGGAAAGTGGGGAGAATCTTCTGAGCACTGGCA
GGGAGGGGCGGCTCCACATCCTCCTTTCTAAGGTGGCGCCTCCTTCTCCCCCAGGTGGTCAGGACAAGCCCTTGCTGTCT
GCCTGGCCCAGCGCTGTGGTGCCTCGAGGAGGACATGTGACTCTTCTGTGTCGCTCTCGTCTTGGGTTTACCATCTTCAG
TCTGTACAAAGAAGATGGGGTGCCTGTCCCTGAGCTCTACAACAAAATATTCTGGAAGAGCATCCTCATGGGCCCTGTGA
CCCCTGCACACGCAGGGACCTACAGATGTCGGGGTTCACACCCACGCTCCCCCATTGAGTGGTCAGCACCCAGCAACCCC
CTGGTGATCGTGGTCACAGGTCAGAGGACTCATGTCTGGGCTTCTCCTTCTCCCACTTCCTGAATCCCAGAGCATCTGGT
GGGGGTGTCCACCAGGGTCCAATCATCCAGGCCCTGACTGTATTTGGTGTCAATGGGGATTGAATACAGGGGAATGGGTG
CTGTGGTGGAAAGAGTAACTGTCGGCAGCATGGCTATATTGTAATCCTTGGAGCCTGTGACTATTTATGTTATAGGACAT
GGGACTGAAGGGGAAGATGGAGTTCAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGACGACCTGGACTCTCCCACTGG
GCTCAGTGTAATCACAAGGGTCCACATGAGAGGAGGAGGAAGAGGAGAGTGGGGATTAGAGCAGCGTAGTGGGAGGGAGA
GTCCACCAGCCACTGCGGGCTTTGAAAGTGGAGGAAGGCCAGAAGCCACGGAATGCAGGTGGCCTTTAGGGGCTGGAGAA
GTCAATGGAACTGATTCTCCCGAGTCTCCAGAGGGAATGCAGCCCTGCAGATGCCTTGATTGTAGCCCAGGAAGAACAGG
GTCTGATTTCTGTCAACAGAAGTGTTCTCTCCCGCCGCCGTGTTTGTGATAATTTTCTGCAGCAACAACAGGAAACAACA
CAGGAATCCAGGTCAAGGACAAGTTAAAAAACCAAACAAGAGGGTTGGCTACCCTAAGGTCAGCAAGGGTGCACTGCTGA
TGCCACCACCAGGCTGGAGCCGCATAGGGAGGGATCCACAGGGAGAGTCGGGGGTGGAGGGTGAGAGAGAGAGAGAGCAT
TAGGTCATAGAGCAGGGGAGTGAGTTCTCAGCTCAGGTGTGAGGGGAGCTGTGACAAGGAAGAACCTCCCTGAGGAAACT
GCCTCTTCTTCCAGGTCTATTTGGGAAACCTTCACTCTCAGCCCAGCCGGGCCCCACGGTTCGCACAGGAGAGAACGTGA
CCTTGTCCTGCAGCTCCAGGAGCTCATTTGACATGTACCATCTATCCAGGGAGGGGAGGGCCCATGAACCTAGGCTCCCT
GCAGTGCCCAGCGTCAATGGAACATTCCAGGCTGACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACACATGCTT
CGGCTCTCTCCATGACTCACCCTATGAGTGGTCAGACCCGAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAGCC
CATGCCTGTCCCATGTCCTGTGATCCTAGAGCCTTAGCTGAGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGACAGAT
GCAGAGAGAACACGCAGCATGGTGTGAGGGAGGGATCAGGGCACAGGATGGCAGACAGGGCACCTCCAAACCCTCCTGCA
CGGCCTGCATGGAGGCCCGCGGCCAGGGCTCCAGGCACCCAGGCAGATGGAGAAAGTGGTCAGGACAGACCCAGAGGAGG
GAGACTCGGCTCAGTTTGGGGAGATCAGAGGCTCCCTCAGACCCTAAACCTTACCCATTTCCCAGAAGCCCATACTGGCC
TCTCACCCACACAGAGATGTCATCACCAGCAACCCCTACACCCTTTTCTTTCCGTTTGAAAAAACATTTATTTAGGTTAA
ATGTAACTATATAATTTGCCACCTTTACCATTTTTAAAAGTAAAATCTAGTGGTCATAAATTCCTTTATATGCAGGGTGC
AGTGGCTCACAGTTATAATCTCGGTGCTTTGAGAGGCCAAGGAAGGTGGATCATTTAAGATCAGAGGCTCGAGATCAGCC
TGGCCAACATGAGGGAAATTCATCTTTACTAAACAGACAAGAAAAATTGGCTGGGCATGCTGGCATGCACCTGTATTCCT
AGCTACATGGGAGGCTGAGGCAGGAGAAGTACGTAAGCCCAGGAGGCAGAGGTTGCACTGAGCTGAGATCAGGCCACTGC
ACTGCAGCCTGGGAGACAGAGAGAGATTCTGTCTCTAAATAAATAAATACATCTATATTCTTTTTTATTGTTGTTGTTAC
ACTCCACCCTTTACTTCCTGCCCTCTGGTAGCCACCATTCTACTCTCTACCTTCATGAGATCCACCTTTTAGCTCCTGTA
TATGGGTGAGAAATGGGAATCTTTGCAATGACCTCCAGTTCCATCCATGTGGCTGCAAATGTCAGGATGTTATTCTTTCT
ACGGATGAGTACTCTCCACTGTGTGTGTGTACTACATTCTCTCTATCCATTCACCCACTGACGGGCAGGTAAGTTGACTC
CACATCTTGGCTACTGTGAACAGTGCTGCACCAATCGTATGAGTGCAGATATCACTTCGATACACTGATGTCCTTCCCTT
TGGGTTTACACCCAGTAGTGGAATTGCTAGATCCTATCAACAGGGTACCAGGGTTCTCCTTTCTCTACCACCTTGCCAGC
ATTTATTTTGTCTGTGTTTCAGATAAAAGCCACTTTAATGGGATGAGATGATAGCTCACTGTGATTTCAATTGGCATGAT
TAGTGATACTGAGCACTTTTTCATGTACATGTTCGCCATTTGTACGTTTTGTTTGTTGAGAAATGTCTGTTCAGGTCTTT
TACTAATTGTTAAATTAAATTCATTGTTTTATACCGTTGCTTGAGTTTTATGTATATTCTAGTTATTAATCCCCTCTCAG
ATGCATACTTCACAAATATTTTCTCCCAATTTGTCTCTTCTTCACTTTGTTGGTTGCTTCCTTTGCGGTGCAGAAGCTGC
TTACTTTGATGTAATCCCGAAGGTCTATTATTTTGTTTTGATTTCTTGTGTTTTTGAGATTTCAAATAAAATGTCTTTCC
TCAGACAAATGTCCTGGAGCATTTCCCCACTCTTTCCTTTTAGACGCTTAATGGTTTCAGGCCTTAAGTGTTTCTTCCAT
TTTCATTTGATTTCTGTGTATGGTGAGAGGTAGAGGTGCAGTTTCATCAACTGCATGTAGATACCAGTTTTCCCTGCTCC
ATTTATTGAAAAGACCGTCGTTTCCTGATTGCAGGTTCTTGGCACGTACAATCGTCAAAGTCCATTGGATGTGAATGCAT
GAATTATATCTGTGTTCTTCATTCTGCTCCATTGCTCTAAGGGCCTTTATGCCAATGTCATGCTGTTGTGCTTACTACAG
CTTTGTAACATATTTTTAAGTCAGGGAGTGTGAGGCCTCCAGCACCTGTTTTGTCTTTATACCTCGAAATCTCAGGACAC
TGGGCATCATTTAACAATGATGATGGAGAAGGGGACGCCAGGACTCCTAGGGCCCAACATTAGATAACAGAGTGTTGGCC
ATGAACCAACCTCAAAGATTTCCTTTGAGTAGAAGACAGGCATCCTCATTTCCTCACCTCTCTCCTGTCCTGTGTTCTAG
GAAACTCTTCAAGTAGTTCATCTTCACCCACTGAACCAAGCTCCAAAACTGGTGAGTAAAGATCCCTCTTATCTCTGCTT
TTGGAAACCTGGGGAGGTTGGTATCTTGGATTCAAGCATTGGCTCAGCACCTCCCAGCTCTGTGATTGTGGGCCTGTCTT
CTAACATCTCTGACCCCCAGACACTACAACAGCGAAGGGTATCTGAGGACAGCAAAGGGCTCAGTGAAGTCTCTTCATTT
CAAATTTCTGCAGCTGAGACCTCCTCCAAGCTAGACGGACGAGTACAAATCTGACATCCTTCTCAGGGATAAAGTGGTGT
TTTTTCTGCCTGCATTCCAAATTGGAGGATAAATTTGAGGGGACTTGAGAGAGGGAGGGGAAGGGAACATCTGATGAGGG
AAAGGTGATTTAGAGAAGTTCCACTTGCCAAGGAATGAGCCCCTGTTGGTCATGATGCGACCTTGGCTGAGTCAGCAGAG
CAAGAGCCTTGCAGTAAGAAGGAACGTAGTTCATCCACAAATATGACACTTCCACTTACTCACTTATTCAGCCACTGCCC
TGTGCTCTGACTGTACAGTGTGGAACCCTTTCCTGCTGTTGCCATAATAAATCTCCACAATCTTCATGGATGACAACAAC
ACAGCTTTTAAAATTATCTTACAGTGTTATAGCTCAGAAATATGAAATGCATTTCACTGGGCTAAAATCAAGGTGACTGC
GAGGCTGCCTTTTCTCTGAAGGTTCCAGGCGAGAATCGGCTTTTCACATTTCCCAGCTCCCAGAGGTTCCCACGCTCCTT
GGCATCTGGTCCCCATCCTCCTTCCTCGAAGCCCACAAAAGCTCATCACATCTCTCACGTGGCATCACTCAGATCCCTCT
TCCTTACCTCACCTCTTTCTCTAAGTGTTGCTCTGACTTTTTCTTCCTCTTTTAAAGACTTTGGGATTCTATTGAGTTTA
CCAAGATAATCCATCACAATCTCCCTAAAATCACCCAAGATAACCTCTTTTTAAGTTCAGCTGATTAGCAACCATAATTC
CATCTGCAATCTTTATTCCTCCTTTCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGG
GTGGGCCAGCATTCTCCTGCCTTCCACAAATGGTAAACACGATGCATTTGGCCTCTGCTCTTAGGACACTGACATTGCAG
ATGGGCAAATGGGAGGGCAGAATATGAATGCACAAGTGGACCAGTAATGATTGATCCATTGGGAAGCATCCGTGCATGAA
ATCTATTTACCTATTTATTTATCTATTTATCTATTTATGTATTTATTTATTTGCGGCGAAGTCATTCTCTGTCCCCGGGC
TGGAGTGCAGTGGCATGACCTCAGCTCACCACAACCTCCGCCTCCCGGGTTCAGGCGATTCTCCTGCCTCAGCCTCCTGA
CTAGTTGTGATTCCAGTCCCCTCCACCACACCCAGCTAATATTCTTTTATATTTTTTAGTAGAGATGGAGTTTCACCATG
TTGCGCAGATTGTCTCCAACTCCCAACCTCAAGTGATCCGACCGTCTCAGCATCCCAAAATGCTGGGACTCAAGGTGTGA
GCCACTGCGCCCAGCCGAAATTTAAAATAAATAATAAAGAATTCTAAGTGTATAATTTCAGGAGACAGAGAAAGTCTCAC
TAATCAGATAATATTTGTGACCATAATGAAAAAAAAAAGTAGATTCAACCCCTGGAAGATTGGCGGAAGGATTTTCCACA
CACAGCTGTCAGCCGTGAAGGCACAAATGTGAAAACAATCTGATGTGGAAGGAAGAGGCTCTGCATTCAAATGCTGGGAA
TGAAGTGGGGAGAATGACAAGACGACTGTGGAGAGACGGAGAGCACTCTGGGTACACAGGAAACTAAGGAGGAACAAGGA
GCGTGTGTTTGACACTCACAGCCATTGGATTCACCTCGGGGTAGCCAGGAATCCCTACATGATTAATATGACTGACATGA
AAATAAGGACGCCCAAGTGCGTAACTGGAATCTAGGAGACCGTGGAAAAGGCAATTCCCGCCCCACTGGTGAAATGTGGT
GCTGATTTAGACACTAAATGAATGAAGTAGATGGGTATAAGATATGTCTGTGAGGTAGAATCATTTGTAGGGAGGGCTTG
CTGGATTTGATAATGCCTACTTATTTAATTTTGAATATATTAATTTCTTTCTGAGATTTATTTTTCCTACATGTAAATCA
ATATCTGGCAGAGGAGTGATTGATAGATAGATGAGGGGTGGTGCAAATGAAGGGACTTATTATAGCATAATATACAAGTC
TGTGAATGGGAGCTTACGCCTGTAACCCAACACTTTGGGAGGCCAAGGCGTTTGGATCACTTGAGGTCAGGAGTTTGAGA
CCAGCCTGGCCAACATGGAGAAACCCCATGCTCTTTTTAGCAACCAGTCCTAGGGACCTCATGGAGAACTTGCCAACCAC
GTCTCATGGGGACAGCATTAATGTATTCATGATGGATCCACCCCCATAACTGGAACGTCTCTCAATAGGCCCAGCCTCCC
ACACTGCGAGATAAGTGTCAACGTGAGGTTTGGCGGGGTCAAACATCCAAACTATAGCAGTGGTATCCCCAGCATGTTCT
CTGATTATTTTGAGAACTATAACTGAGAAAGCAGGAGAAAGCTGGGTATCCTGCCATCGGGGAACTTGTCCTAAACAGAT
GTTGTATGTGCTTAGCTGGCAACCAAGAAATGAGAGACAATCCATAAAGAGGAACTGCTATAATTAGCTTCTTATTGGAT
TCCCACCTTCCCCCAGGTATCCGCAGACACCTGCACATTCTGATTGGGACCTCAGTGGCTATCATCCTCTTCATCATCCT
CTTCTTCTTTCTCCTTCATTGCTGCTGCTCCAACAAAAAGAGTAAGTCTCACGAAGCAGAGGTCAGAGAGCTCAGGACCA
TGTGGGGAAGCAGGATGGGAGCACACTGGTGTGTGTTCCTGACTGGCAGGATGGTCCCTGGACCAAGGCAGGAGCCACAG
AGGCAGGGCTTTCTAGAGAGAGCACCAGACACCCTGCCCCTGCCTTCAGCTCACAGACCATTGCCTGATTCTGAACTGTA
TCCTCACGTCCCCTGCAGCCACTGACATCCAGGAGAAGGTTCCATGACAGGCAGAAAGGGGAGACAGAATCACTGGGATG
GGAACTCAGAGCTATTCATGGGATGGGTCCTTGAGCTCAGAGAGATAGAATGTCTGGGTCTGGCTGATGACAGCTGAGGG
ACCTCAGGCACCTACGGCCTCCCGCTGTGTGTTGGTGTCTGCTCATGAAATGAGGACCCAAAAGTGCCCTTCCAGCTGTT
TTGATGACTTCTATCTCCTACAGATGCTGCTGTAATGGACCAAGAGCCTGCCGGGGACAGAACAGTGAACAGGGAGGTAG
GTTCTCCTCAGCCCAGCCTCATGGATTGAGTCTCATTCCCTAATAGTCTTGAAGAATGTGAGCACCCTCCCTCACTCAGC
ATTTCCCTCTCTCCAGGACTCTGATGATCAAGACCCTCAGGAGGTGACATATGCACAGTTGGATCACTGCGTTTTCACAC
AGACAAAAATCACTTCCCCTTCTCAGAGGCCCAAGACACCTCCAACAGATACCACCATGTACATGGAACTTCCAAATGCT
AAGCCAAGATCATTGTCTCCTGCCCATAAGCACCACAGTCAGGCCTTGAGGGGATCTTCTAGGGAGACAACAGCCCTGTC
TCAAAACCGGGTTGCTAGCTCCCATGTACCAGCAGCTGGAATCTGAAGGCATCAGTCTTCATCTTAGGGGATCGCTCTTC
CTCACACCACAAATCTGAACATGCCTCTCTCTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAGAAGACACA
CTCCTTTGCTTAGCCCACAATTCTCTATTTCACTTGACCCCTGCCCACCTCTCCAACTGAACTGGCTTACTTCCTAGTCT
ACTTGAGGCTGCAATCACACTGAGGAACTCACAATTCCAGACATACAAGAGGCTCCCTCTTAACATGGCACTGAGACACG
TGCTGTTCCACCTTCCCTCATGCTGTTTCACCTTTCCTCAGACTATTTTCCAGCCTTCTGTCAGTCAGCAGTGAAACTTA
TAAAATTTTTTGTGATTTCAATGTAGCTGTCTCCTTTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR