Allele Report for 2DL1*01201


2DL1*01201
Previous Designations & Local Names: GM17119, KIR2DL1_CONS
IPD Acc No: KIR00331
Assigned: 24-AUG-2008 Sequence Last Modified: 16-AUG-2010
Source Entries: EU930370 , GU182357  
Cells Sequence Derived From: GM17119 , RSH  
Known Ethnic Origin Of Source: Black
Publications
Hou L et al. Tissue Antigens 76:31-34 2010. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
Protein Sequence (348 aa)
MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGV
SKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHL
SREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQ
RPKTPPTDIIVYTELPNAESRSKVVSCP
Nucleotide Sequence Data (1047 bps)
ATGTCGCTCTTGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACATGAGGGAGTCCACAG
AAAACCTTCCCTCCTGGCCCACCCAGGTCGCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCA
TGTTTGAACACTTCCTTCTGCACAGAGAGGGGATGTTTAACGACACTTTGCGCCTCATTGGAGAACACCATGATGGGGTC
TCCAAGGCCAACTTCTCCATCAGTCGCATGACGCAAGACCTGGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTC
CCCCTATCAGGTGTCAGCTCCCAGTGACCCTCTGGACATCGTGATCATAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTCTGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTA
TCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGGGCCCAAGGTCAACGGAACATTCCAGGCTGACTTTCCTCT
GGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCATGACTCTCCATACGAGTGGTCAAAGTCAAGTG
ACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTAAC
CCCCGACACCTGCACATTCTGATTGGGACCTCAGTGGTCATCATCCTCTTCATCCTCCTCTTCTTTCTCCTTCATCGCTG
GTGCTCCAACAAAAAAAATGCTGCGGTAATGGACCAAGAGTCTGCAGGAAACAGAACAGCGAATAGCGAGGACTCTGATG
AACAAGACCCTCAGGAGGTGACATACACACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAG
AGGCCCAAGACACCCCCAACAGATATCATCGTGTACACGGAACTTCCAAATGCTGAGTCCAGATCCAAAGTTGTCTCCTG
CCCATGA
Genomic Sequence Data (14737 bps)
GTTCGGGAGGTTGGATCTCAGACGTGTTTTGAGTTGGTCATAGTGAAGGACACTAGGTGTCAAATTCTAGCGAGAACAAT
TTCCAGGAAGCCGTGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCC
TCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTCGGTC
GCGGCTGCCTGTCTGCTCCGGCAGCACCATGTCGCTCTTGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAAGCAA
TAGAGGGAGGGAGTGAGGGGATGGAGATCTGGGCCCAGAGGTGGAGATATAGGCCTGGAGGTGGAGTTATGGGCCTGGAG
TGGAGATCTGGGCCTGGAGTGGATATATGGGCCTAGAGATGGAGTGATGGGCCTAGAAGTGGAGATCTGGGCCCAGAGGT
CGAGATATAGGCCTGGAGGTGGAGTGATGGGACTGTAGTGGAGATCTGGGCCTGGAGTGGAGATAGGAACCTGGAGGGGA
GATAGGAACCTGGAGGGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGTCATGGGCCTGGAGGTGGAGT
TACGGGCCTGCAGTAGAGATATGGGCCTGAAGTGGAGACATGGGCCTGGAGTGGAGATATGGGCCAGGAGTGGAGATATG
GGCCTAGAGGTCGATATCTGGGCCTGGAGTGGAGATATGGGCCAGGAGTGGAGATATGGGCCTAGAGGTCGATATCTGGG
CCTGGAGAGGAGATATGTGCCTAGGATGGAGATACGGGCCTGGGTGTGGAGATATGGGACTGGAGAGGATATATGGGCCT
GGAGTGGAGATATGGGACTGGAGAGGAGATATGGACCTGGAGTAGAGATAAGGGCCTGGATTGGAGATATGGGCCCAGGG
TGGAGATCTGAGCCTGGATTGGAGATATGGGCCTGGATTGGCGATATGGGCTTAGGGTGGAAATATCGGCCTGGAGTGGA
GATATGGGCCTGGAGTGGAGATATGGGCTTGAGGTGGGGATATGGACCTGGAGGCTGGGTATCTGCACAGCCGACAGCCC
TGTTCTTGGGTGCAGGTAGGCACTGAGGGTGAGTTTACCTTCAGCCCAGGAAGGGCCTGGCTACCAAGACTCACAGCCCA
GTGGGGGCAGCAAGGGTGCCCTGGTTTGCCTGCAGATGGGTCATCCATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTG
CAGGGGGCCTGGCCACATGAGGGTGAGTCCTTCTCCAAACCTTCGGGTGTCATCTCCCCACATAAGAGGATTTTCCTGAA
ATGGGAGGGAAGTCCTGTCAGGGAGTCTCTCATAAACTAGGAAGAAGGGACCCTGGGGTGCTGGGCCCACATTTCTGACC
TTGCCTCCCTGGCCTTTCATTCCCTTGGCAGAGTCAAGTTCTGTGGGGACCAGGGTTAGACTACGGTGCTCAAAGCTGGG
GTGTGTGGTGGGGAAGTGGTAGGAACAGCAGATCCTCTGAGGACAAAGGTGTTACTCAAACACTTCAGTGTTTCCATGAC
GGTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCAGAAGAGGTGGGAAAACCACAGCCATGGCCCTGACATTCCAATCC
TCTGATGGGGACTCAGTTGTTTATTTTCGTTCAGGCATCGGCTGATATTCCATTCTCAAAGGACATGCCCTCCACCCCAT
GTCTACCCTGTGTTGTTTTATGTGAGTAATCTTACAGTATTAAAATCTAGTAGGAGTCTCTTACTCAGCACTTGCTCAAA
GTTCTCAGCTGACACTTTTGTTGTAGGGAGACACCTTGTGTTTGCGGGATGGGTCCTTCCTTTAGCCCTGGGCACCAAGG
TGTGATAGCAGCCATAGAAACTTGGAAAGCGAGGAGAATCTTCAGAGCACAGGGAGGGAGGGGCGGCTCCACATCCTCCT
CTCTAAGGCGGTGCCTCCTTCTCCCCAAGGTGGTCAGGACAAGCCCTTGCTGTCTGCCTGGCCAAGCCCTGTGGTGCCTC
CAGGACATGTGATTCTTCAGTGTCATTCTTATCTTGGGTTTAACAACTTCAGTCTGTAAAAGGAAGATGGGGTGCCTGTC
CCTGAGCTCTACAACATAATATTCTGGAACAGCCTTTTCATGGGCCCTGTGACCCCAGCACACGCAGGGACCTATACATG
TCGGGGTTCACAACCACACTACCCCAGTGGGTGGTCGGCACCCAGCAACCCCCTGGAGATCACGGTCACAGGTCAGAGGG
CTCCTGTCTGGGATTCTCCTTGTCCCACCTCCTGAATCCCAGAGCTCCTGGTGGGCGTGTCCTTGCGGGTCCCATCATGC
AAGTCCTGACTGTATTTGGGGTAAAGGGGGATTGAATACAGGGAAATGGGTGCTGTGGTGGGAAGAATAATTGTCCCCAG
TGATGACTACATTCTAATCCCTGGAGTCTGTGACTATTTATGATATAGGGGAAGGGACTGAAGGAGAAGATGGAGCTCAG
GTTGTTGATGAGTTGACCTTGAGATGGGGAGACAGCCTGGACTGTCCTGATGGGCTCAGTGTAGTCACAGGGGTCCACAT
GAAAGGAGGAGGAAGAGGGGAGTGGGGATTACAGCAGCATAATGGGAGTCTCCATCAGCTTTGAAGGTGGAGGAAGTCCA
GGAGCCATGAATGCAGGTGGCCTATAGAGGCTGGAAAAGTCAAGGAACTGATTCTCCTGAGTCTCCAGAGGGAACGAAGC
CCTGCAGGTGCCTTGATTTTACCCACGACAAACAGGGTCCGATTTCTGTCTCCAGAATTGGAAGGGGTTAGTGTGCTCTC
TCCTGGTGCCATGCTTCTGATAATTTTCTACAGCAGCAACAGGAAACCAACACTGGAACCCAGGTCAAGGACAAGTTAAG
AAACAACACAAGGATAGCCAGGCATGGTGGCAGGTGCATGTAATCCTAGCGACTTGGGAGGCTGAGGGCAGGAGAATCAC
TTGAACCCAGGAGACAGAGGTTGCAGTGAGCCTAGACCACACCACTTCACTCCAGCCTGGGCAAAGGAGTGAGACTCTGT
CGCCAAAATTAATTAATTAATTAAAGAAACCAAACAAGGAGAAGGTTGGCTACACTGAGATCAGCAAGGCTCAGATGATG
ATGCCACCACCAGGCTCCATCCACATAGGGAGCGGTTGATACTCCTCCAACCAGCACCAGGAGCCAGCCTATGGAAGCTG
GCACTGGCATGGCAAGAGTGGCTCCCAGTCCCTACCAGGAACAGGGTGTGTGGCCACTGGTGCCTGCCTTACTGATCAGT
TCATACCTCCTGCCAAGGATTCCAATTCGTCCAAAAGAGATTGAACCAGGCTGCTAAGAGCCTGGATGTGCAGCCTATCC
TGGTTCCTCTTCCACCCCCACATAGACAGCAGGAAAGACATTAGTTCGAAATAGATACAACAGCCCAAGAGATGAGGCTG
AGCCCAGCGGCAAGGGAATCAGAGGCTACTAGAGACAGAGGGACAGAGAAGAGTGAGGGAGACAGATGGAAGGACCTGCA
CCAGGAGTTATGGGCACAGAAAAGAACATGAAGACACAGAGAGGAAGGAGAGAGATAAGACACCAGGAAGGGGAAGCCTG
ACTCAATCCAGGTGCCATGGATGGGATGATAAAGAGAGACACCTTCTAAACTCACAACCTCTCTTCCTAGGAGTCCACAG
AAAACCTTCCCTCCTGGCCCACCCAGGTCGCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCA
TGTTTGAACACTTCCTTCTGCACAGAGAGGGGATGTTTAACGACACTTTGCGCCTCATTGGAGAACACCATGATGGGGTC
TCCAAGGCCAACTTCTCCATCAGTCGCATGACGCAAGACCTGGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTC
CCCCTATCAGGTGTCAGCTCCCAGTGACCCTCTGGACATCGTGATCATAGGTGAGAGTGTCCAGACTTTCTTCTCATTGT
CATTGGGATGCAGAGTGAATGATCCAGGAATTGGAGACCCAGGTGGCTGTAAGGAAGATGAGCTTGGTATTCTTATGGAG
AGAGACTGACTTGGTGAGGTCTGTGCCAACAGAGACAGAGAAACAGGAGACACAAGTAGAGACCAGGTGTCATAACAGAG
AACAGACACAGGGGCCATACCGGGAGTTAGAAAAGACAGAAAGAGTTAAAGGAGACACACAGACAGACATGTCCCAGAGA
GAGGTGTCCCTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTG
TTCTCTACCAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCACCTAC
AGATGCCATGTTTATTCTGACACCTCTGCCTTCCATGTAATGGAGAGTAATCGTCCCAGGATATCATGGCCCCACAACAC
CAACCCCTGTATGCTGTGTGAACTTGTAGTCTCCAGACTGGATTCTGAGGCTCATATTCCAAATAAGCCCACTTATGAGA
GGATCAGTGAGAGGCACAGAGAGAAATCAGGGACACCAAAAAGCAAAGACATAAACACACAGAGAATGAGCCAGAGGAAG
GAGATTGAGAGACTCACAGACACATAAAGAGAGAGAAAAGAGGGCAGAGAAGTGAGAATGATGGAAGGGAGCAGAGAAAA
GCACTAAAATTAGACTCCTGAGGGAGAGGCACAAGGACATTGAAAGATGGAGATGTGGGGATGAATTGCAGAGATTCCAA
AGAGAACTAGAGAGACCGAGAGGCAGAGCAAGACAGATGATAGATGGATAGATATAGATAGATGATAAATAGGTAGATGA
TAGATAATAGGTTATAGATACATAGATGATGATTGATTGATTCATTAATAGATGAGACATAGAGATGATGATGATGAAGA
CAGATAGATAGATAATACATAGAGATACAGAGGCAGACATAGAGAAATCATAGAGAGAGAGAGATGATACATAGATATAG
ATAATAGATGATTGATGGATAGATAGACAATTGATGGATAAATAGATGATATATAGATATAGATGACAGGTAGAGAATTT
GTAGATAGGCACCGAATAGATAAATAGATAGATCGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACAGGACACA
AAGTGAGAAACTCAGAATTAAAAAAAGTAACATCAAGTCAACCAATCCAAGGAGAGTCAGAGAGAATAAAACAATCCAAA
AAGAGAAAACATATCTAGAGGTGGGGAAGTGAGGTCAGAGACCTAGAGAGACAGAGAAGGTGGAAGGAGGAAATAGACAT
GAAGAGCGATGGGGTAGAGGGTGAGAGAGAGAGAGAGAGAGCATTAGGTCATAGAACAGGGGAGTGAGTTCTCAGCTCAG
GTGAAGGGAGCTGTGACAAAGAAGATCCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTC
TCTCAGCCCAGCCGGGCCCCACGGTTCTGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATG
TACCATCTATCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGGGCCCAAGGTCAACGGAACATTCCAGGCTGA
CTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCATGACTCTCCATACGAGTGGTCAA
AGTCAAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAGCCCATGGCTGTCCCATGTCCTATGATCCTAGAGCCTT
AGCTGAGGAGCTTCCTGCTGAGGATGGAGAGAAGCATGGACAGATGCAGAGAGAAGACGCAGCCTCGGTGTGAGGGAGGG
ATCAGGGCACAGGATGGCCGACAGGGCACCTCCAAACCCTCCTACATGGCCTGCATGGAGGCCCACGGCCAGGGCTCCAG
GCACCCAGGCAGATGGAGAAAGCGGTCAGGAGAGACCCAGAGGAGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGTTC
CCTCAGCCCCTCAACCTTACCCATTTCCCAGAAGCCCATCCTGGCCTCTCACCCACACAGAGATGTCATCACCAGCAACC
CCTACACCCTTTACTTTTCTTTGAAGAAATATTTATTGAGGATAAATATACCTATATAGCTTACCACTTTTAACATTTTT
TTTTGAGGTGGAGTCTAGCTCTGTCCCCTATGATGGAGTGCAGTGGCACAATCTCAGCTCACTGCAACCTCCGCCTCATG
GGTTCAAGCGATTCTCCTGCCTCAGCCACCTGAGTAGCTAGTGCTACAGGCACGCACCACCACGCCAGGCTACTTTTTGT
ATTTTTAGTAGAGAGGTGGTTTCACCATGTTGGTCGAGCTGGTCTCGAACTCCTGACCACGTGATCCACCCGCATCAGCC
TCCCAAAGTGCTGGGATTACAGGCATGGGCCACCAGGCCCAGCCACATTTACCATTTTTAAGTGTAAAGTCTAGTGGTCA
TAAATACATTTTTATATATATATATATATACATTTTTTTTACCCTCCACCCTTTTCTTCCTGTCCTCCAGTAGCCACCAT
TCTACTCTCTACCTTCATGAGATCCACCTTTTAGCTCCTGTATATGGGTGAGAAATGGGAATCTTTTTAATGACCTCCAG
TTCCATCCATGTGGCTGCAAATGACAGGATGTTATTCTTTCTATGGATGAGTAGTCTCCACTGTGCGTATGTACTACATT
CTCTCTATCCATTCACCCACTGATGGGCAGGTAGGTTGACTCCTCATCTTGGCTACTGTGAACAGTGCTGCACCAATCAT
ACGAGTGCAGATATCACTTCGATATGTTGATTTACTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGATACTATG
AAAGTTCTCTTTTTTTCTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGCCCAAGCTGGAGTCAAAGTGGTGCAAC
CTTGGCTCATTGCAACCTCCGCCTCCTGGGTTCAAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCTGGGATTACAGGTG
CACACCACCATGCCTGGCTACTTTTTGGTTTTTTTAGTATAGATGGGGTTTCCCCATGTTGGCTGGGCTGCTCTCAAACT
CATGACCTCAACTGAGGTGCCCGCCTCAGTCTCCCAAAGTGCCGGGATTACAGGCATGATCCACCTCACCCAACCTCTTT
TTAGTTCTTTAAAGGACTTCCATACTTTTCTCCGTAATGGCTGTACTAATTTACACTCCTCCCAACAGGGTACCAGGGTT
CTCCTTTCTCTACCACCTTGCCAGCATTTCTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTTATTTCATTTTATTT
TGAGATGGAGTTTTGCTCTTCTCACCCAGGCTGGAGTGCAGTGGCGCTATCTCGGCTCACCACAACCTCCACCTCCCAGG
TTCAAGCGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGAATTACAGGCACACGCCACCACGCCCTACTAATTTTTGTAT
TTTTAGTAGAGACAGCGTTTCTCTATGTGGGTCAGACTGGTCTCAAACTCCCAACCTTATGAGATTCACCCACCTCAGGT
TCTCAAAGTTCTAGGATGACACAAGTGAGCCACCTCACCCGGCCTAAAAGCCATTTTAATGGGGTGAGATGAAAACTCAC
TTTGATTTTAATTTGCGTTTCTCTGATGATGAGTGATACTGAGCACTTTTTCGTATGTGGGGAAATTTCATGTCTTTTGC
TCCTTTTTCAATTAAATCATTTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCTAGTTATTAATCCCATCTCAGATGC
ATAGTTTGCACATATTTGCTCCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCAGTGCTGAAGTTGCT
TAGTTTGAGGTAATCCCAATGGTCTATTTTTGCTTCGATTACTTGTGTTTTGAAGGTTTAAAACAAAATGTCTTCCTTCA
GACAAACGTCCTGGAGCATTTCCCCAATATTTTGTTCTACGTGTTTCATAGGTTCAGGCCTTAGACTCACATCTTTAATC
CATTTTCATTTGATTTTTGTGTATGGTGACAGGTAGAGTTGCAGTTTCATTCCTCTGCATGTAGATGTCCAGGTTTCCCT
GCACTGTTTATTGAAAAGACTGTCCTTTCCTGATTGTGAGTTCTTGGCATCTTTGTCAAAGTCCATTGGATGGGCTGGGC
TTGGTGGCTAACACCTGCAATTTCAGCACTTTGGGAGCCCGAGGTGGGTGGATCACCTGAGGCCAGGAGTTCAAGATTAG
TCTGGCCAACGTGATGAAACATCGTCTCCACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCACCTGTAATACCA
CTACTCAGGAATTTGAGGCAAGAGAATGATTGAACCCAGGAGGCTGAGGTTGCAGTGAACCGAGATTGCACCTCTGCACT
CCAGCCTGAGTGACAGAGCAAGACTCCATCTCAAAAGAAAAAATAAAAAACCATTGGATGTAAATGCATGGAATATATCT
GTGTTATTCATTCTGCTCCGTTGTTCTATGTGCCTTTCTTTACGCCAATGTCATGCTATTTTGCTTACTACAGCTCTGTA
ACATATTTTGAGATCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATATCTTGAAGTCTCAAGACAGTGGGTGTCATATAA
AAAAATTATGGAAAAAAGGATCCCAGGACTCCCAGGGCCCAATATTAGATAAGAGAGTGTTGGCCATGAACCATCCTCAA
AGATTTCCACTGAGTGGAGGACAGACACCCTCATTTCCTCACCTCTCTCCTGTCTCATGTTCTAGGAAACCCTTCAAATA
GTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTGAGTACAGAACCCTCTTATATCCGCTTTTGGAACCCTGGGGA
GGTGGGAACCTTGGATTCAGGCGTTGACTCAGCATCTCACAGCTCTGACATTGTACACTTGTCTTCCACCATCTCCGAAC
TCCAGATACTCCTACAGCGAAAGGGATCTGGGCCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTCATTTTATGGAGC
TGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAATGTTTGTTCTACCTGCA
TTCCTAACTGGAGGATAAATTCCTGGAGACTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGCAAGGTGTTTTAGA
GAAGTTCCACTTGCCAAGGAATGAGCTCCTGTAGGTCATGAAGCAACCCTGGCTGACTCCGCAGAGAAAGAGCCTTGCCG
TAACAGAGAACAGAGCTCATGCACGCACATTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTCAGGCTGTGCAGT
GTGGAACCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTTTTTAATTATCTT
ACAGTGCTGTAGCTCAAAGTAGGAAGTGCATCTTACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCTTCCCTCTGAGG
ATTCCAGGCACGAATCTGCTTCTCACTTGTCCCAGCTTCTAAAGGCTCCCAGTTCCTTGGCTCCTGGTCCCCTTCCTCCT
TCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGTGCCTTCTTCCTTACCACACCTCTTTCTCTGA
GTGCTGCTCTCCCTTCTTCCTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCCTCATAATC
TCCTGGAAATCATCCAGGATACCCTTGTTTTAAGTTCAGCTGATTAGCAACCATAATTCCATCTGCAATCTTCATTCCTC
CTTTCCATGTAAAATAACATATTCACAAGCTGTGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGCATTCTCCTGCC
TTCCACAAACAGTGAACAAGATGCATTTGGCCTCTGCCCTTGGGACACTGATATTGCAGATGGTTAAATGGGAGGGCAGA
AAATGAACGCACAAGTGGATCTATAAATGAATGGTCCATTGGGAAGCATCTGTGCATGAAATCTATTTTTTGTTTGTTCT
TTTGTTTATTGAGACAGAGTCGCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCACTGCAACCTGCGT
CTCCTGGATTCAAGGGATTCTCCTGCCTCCGCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCGTGCCCGGCTAAT
TCTTTTTGTATATTTTTTGTAGAGAGGATGTTTCACCACGTTGGCCAAGCTTGTCTGAAACTCCCAACCTCAAGTGATCC
GACCGTCTCAGCATGCCAAAGTAATGGGACTACAGGCGTGAGCCACTGTGCCCAGCCAGAATTCAAAATCAATAATAGAT
AATGCTGAGTGTATGATTTCAGGTGACAAAGAAGGTCTCACTATTCAGATATTTGTGACATTAATGAAAAACACGGAATG
AACCCCTGAAAGATTGGCGGAAGGATTTTGCACACACAGCTGTCAGCCATGAAGGCACAAAGGTGAAAACAATCTGATGT
GGAAGGAAGAGGCTCTGACTCAAATGCTGGGAATGAGGTGGGGAGAATGACAAGACGACTGTAGAGAGACGGAGAGCACA
CTGGGTACACAGGAAACTAAGGAGGAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACCTCGGGGTAACCA
GGAATCCCTACATGATTAATATGACTGACATGAAAATAAGGGAGGCCCAGGTGCATAACTGGAATCTAGGAGACCGTGGA
AAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGATGGATATAAGATATG
TTTGTGAGGTAGAATCATTGACTGGAAAGGCTTACTGGGTTTGATTTTCCTACTTGTTTAATCCTCGCTTAATTAATTTC
TTTCTGAGATTTATTCATCCTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGTGGTGGTGGAAATGAA
GAGACTTATTATAGCATAATATACAAGTCTGTGAACAGTGGCTCACGCCTGTAACCTAGCACTGCAGGAGGCCAAGGTGG
GTGGATTCCATGAAGTCAGGAGTTCCAGACCAGCCTGGCCAACGTGGTGAAACCCTATCTCTACTAAAAATACAAAAATT
AGCCGAGCACGATGGTGCATCCCTGTAATCCCAGCTCCTATTCTGGAGGATGAAGCAGGAGAATGACTTCAACCCAGTAG
GTGGAGGTTGCAGTGAGTGGAGATTGCATCACTGCACTCCAGCCTGGGGGACACAAGGAGACTCTATCTCAAAAAATAAA
AATAAGAAATACATAAATATAATAAAACACACACGAATGACAAAGGCACCTGAATTCCAATCATGATTTTTCTATTTCTC
TATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATGAGCCTAAAACCTCTTCCCTATTTGGCTTTCTGTGAGC
ATGAGATCATATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCACAGATCCTGGAATAGAGAAAGTGCTCTGGTCATCA
CAAAAAAAACTTGCCCACTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCACCTGTGGAGATTCAGATAGACCATG
GGGAGGTAAACATTAACACTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATCAGCGACAGCACTAGCTCCTGCTCCC
CTTTCCTACTAATTCACAGGAGGACAGGTGGTTTTGAAGCAATAGATGGCCGAGGGGGTGGTCCTTCCCCCAGCCTCTCG
GGTAGAACAGCAGCCTAATATGTGTCTCCCGAGATCACAAAGAGCAGCAGGTTTCACACGGGCTTCAACACTATTTCCTG
GCCGTTTGACATAAGAGAATTCTATTTCGCTTTTTTTATCTTGATTTCACTTTTGTTTTCTTTCCTTGGAGAATGCAAGT
TGTTTGATTCAAGAATGCTGTGGATGTAGAAACCCTAAAGCACATTCGCTGTGAATCAATCCCAGTCCAGTCTTCCCAGA
GAAGACTCTAAACACCTCCTGGACTGCACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTCCAGGGAGACAGAAC
ACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAACCTATATTTCAATGT
GACCCAGTCCCTCAAGGCTCAGAAAAGCTCCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAGCTGCGGGAAGCCAG
AAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCTCCAGGAAG
AACAGGAAGACAGCCCAGGGTGTTCTGAGACGTTCCTCCTGATCTCAGGAAGTTGCTGTCTTAGGCCATTTTTGTTGCTC
TAAAGGAACACTTGAGCCTCGGTAACTTCTAAAGAAAAGAGATTGGTTTGCCTCACCGTTCTGCAGGCTGTACTGGAAGC
ATGGCACCAGCATCTATTTCTCGTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTGCAG
AGACCACAGAGATCACACGGCAAGAGAGGGAGCAAGGGGGAGGGGGAGTGATGGAGCTTCCAAGCTCTTTTTAACAACCA
GCTCTCCGGGAACTAATAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGATGTGTTCATGATGGATCCAC
CTCCATGACCCAAACACCTCTCAAGAGGCCCAACCTCCCACAGTGGGGGTGAAATTTCAATGTGAGGTTTGAAGGGGTCA
AACATCTCAACTAAAGTAGTCGTATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAACTGAAAAAGCAGGAGAAAG
CTGGGTCTCCTGCCATCTGGGTGCTTGTCCTAAAGAGGTGTTTTATGTGGTTACCTGTCAATCAAGAAATGCGAGACAAT
TCATAAAGAGGAACTGCTAAGATTAGCTTCTTATTGGTGTCTCATCTTCTTCCAGGTAACCCCCGACACCTGCACATTCT
GATTGGGACCTCAGTGGTCATCATCCTCTTCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCTCCAACAAAAAAAGTA
AGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCACTCAGGTGTGTGTTCCTCACA
GGTAGGATGGTCCCTGGCCCAAGGCAGCAGCCACAGAGGCAGGACTTTCTAGAGAGGGCACCAGACTCCCTGTCCCTGCC
TTCAACTCACAGACCGTTGCCTGATTCTGAACTGTATCCTCATGTCCCCTGCAGCCACTCACATCCAGGAGAAGGTTCCA
TGACAGGCAGAAAGTGGGAGACAGAATCAATGGGATGGGAACTCAGAGCTATTCATGGGATGGGTCCTTGAGCTCAGAGA
GATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGCCACCTATGGTCTCCCCCTGTATGTTGGTATCTGCTT
ATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTGTTTTGTTGACTTCCGTCTTCTACAGATGCTGCGGTAATGGACCAAG
AGTCTGCAGGAAACAGAACAGCGAATAGCGAGGTAGGTACTCCTCGGCCCGGGCTCGTGGCTACTGTTATTCCCAAAGAG
TCCTGGAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGACTCTGATGAACAAGACCCTCAGGAGGTG
ACATACACACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGACACCCCCAAC
AGATATCATCGTGTACACGGAACTTCCAAATGCTGAGTCCAGATCCAAAGTTGTCTCCTGCCCATGAGCACCACAGTCAG
GCCTTGAGGGCGTCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATGTACCAGCAGCTGGAAT
CTGAAGGCATGAGTCTGCATCTTAGGGCATCGCTCTTCCTCACACCACAAATCTGAATGTGCCTCTCACTTGCTTACAAA
TGTCTAAGGTCCCCACTGCCTGCTGGAGAAAAAACACACTCCTTTGCTTAGCCCACAGTTCTCCATTTCACTTGACCCCT
GCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTACTTGAGGCTGCAATCACACTGAGGAACTCACAATTCCAAAC
ATACAAGAGGCTCCCTCTTAACGCAGCACTTAGACACGTGTTGTTCCACCTTCCCTCATGCTGTTCCACCTCCCCTCAGA
CTAGCTTTCAGTCTTCTGTCAGCAGTAAAACTTATATATTTTTTAAAATAACTTCAATGTAGTTTTCCATCCTTCAAATA
AACATGTCTGCCCCCAT

IPD-KIR