Allele Report for 2DL1*010


2DL1*010
Previous Designations & Local Names: MoGe2-2
IPD Acc No: KIR00214
Assigned: 23-DEC-2006 Sequence Last Modified: 04-JUN-2007
Source Entries: DQ371485 , DQ371486 , DQ371487 , DQ371488 , DQ371489 , DQ371490 , DQ371491 , DQ371492 , GQ406044 , GU182343  
Cells Sequence Derived From: FH08 , GM17108 , MoGe2-2  
Known Ethnic Origin Of Source: Black, Caucasoid
Publications
Murdoch S et al. Tissue Antigens 68:72-7 2006. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
Protein Sequence (348 aa)
MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGV
SKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHL
SREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGN
PRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQ
RPKTPPTDIIVYTELPNAESRSKVVSCP
Nucleotide Sequence Data (1047 bps)
ATGTCGCTCTTGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACATGAGGGAGTCCACAG
AAAACCTTCCCTCCTGGCCCACCCAGGTCGCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCA
TGTTTGAACACTTCCTTCTGCACAGAGAGGGGATGTTTAACGACACTTTGCGCCTCATTGGAGAACACCATGATGGGGTC
TCCAAGGCCAACTTCTCCATCAGTCGCATGACGCAAGACCTGGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTC
CCCCTATCAGGTGTCAGCTCCCAGTGACCCTCTGGACATCGTGATCATAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTCTGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTA
TCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGGGACCAAGGTCAACGGAACATTCCAGGCCAACTTTCCTCT
GGGCCCTGCCACCCATGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGACTCTCCATACGAGTGGTCAAAGTCAAGTG
ACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCGAAACCGGTAAC
CCCCGACACCTGCACATTCTGATTGGGACCTCAGTGGTCATCATCCTCTTCATCCTCCTCTTCTTTCTCCTTCATCGCTG
GTGCTCCAACAAAAAAAATGCTGCGGTAATGGACCAAGAGTCTGCAGGAAACAGAACAGCGAATAGCGAGGACTCTGATG
AACAAGACCCTCAGGAGGTGACATACACACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAG
AGGCCCAAGACACCCCCAACAGATATCATCGTGTACACGGAACTTCCAAATGCTGAGTCCAGATCCAAAGTTGTCTCCTG
CCCATGA
Genomic Sequence Data (14746 bps)
GTTCGGGAGGTTGGATCTCAGACGTGTTTTGAGTTGGTCATAGTGAAGGACACTAGGTGTCAAATTCTAGCGAGAACAAT
TTCCAGGAAGCCGTGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCC
TCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTCGGTC
GCGGCTGCCTGTCTGCTCCGGCAGCACCATGTCGCTCTTGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAAGCAA
TAGAGGGAGGGAGTGAGGGGATGGAGATCTGGGCCCAGAGGTGGAGATATAGGCCTGGAGGTGGAGTTATGGGCCTGGAG
TGGAGATCTGGGCCTGGAGTGGATATATGGGCCTAGAGATGGAGTGATGGGCCTAGAAGTGGAGATCTGGGCCCAGAGGT
CGAGATATAGGCCTGGAGGTGGAGTGATGGGACTGTAGTGGAGATCTGGGCCTGGAGTGGAGATAGGAACCTGGAGGGGA
GATAGGAACCTGGAGGGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGTCATGGGCCTGGAGGTGGAGT
TACGGGCCTGCAGTAGAGATATGGGCCTGAAGTGGAGACATGGGCCTGGAGTGGAGATATGGGCCAGGAGTGGAGATATG
GGCCTAGAGGTCGATATCTGGGCCTGGAGTGGAGATATGGGCCAGGAGTGGAGATATGGGCCTAGAGGTCGATATCTGGG
CCTGGAGAGGAGATATGTGCCTAGGATGGAGATACGGGCCTGGGTGTGGAGATATGGGACTGGAGAGGATATATGGGCCT
GGAGTGGAGATATGGGACTGGAGAGGAGATATGGACCTGGAGTGGAGATAAGGGCCTGGATTGGAGATATGGGCCCAGGG
TGGAGATCTGAGCCTGGATTGGAGATATGGGCCTGGATTGGCGATATGGGCTTAGGGTGGAAATATCGGCCTGGAGTGGA
GATATGGGCCTGGAGTGGAGATATGGGCTTGAGGTGGGGATATGGACCTGGAGGCTGGGTCTCTGCACAGCCGACAGCCC
TGTTCTTGGGTGCAGGTAGGCACTGAGGGTGAGTTTACCTTCAGCCCAGGAAGGGCCTGGCTACCAAGACTCACAGCCCA
GTGGGGGCAGCAAGGGTGCCCTGGTTTGCCTGCAGATGGGTCATCCATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTG
CAGGGGGCCTGGCCACATGAGGGTGAGTCCTTCTCCAAACCTTCGGGTGTCATCTCCCCACATAAGAGGATTTTCCTGAA
ATGGGAGGGAAGTCCTGTCAGGGAGTCTCTCATAAACTAGGAAGAAGGGACCCTGGGGTGCTGGGCCCACATTTCTGACC
TTGCCTCCCTGGCCTTTCATTCCCTTGGCAGAGTCAAGTTCTGTGGGGACCAGGGTTAGACTACGGTGCTCAAAGCTGGG
GTGTGTGGTGGGGAAGTGGTAGGAACAGCAGATCCTCTGAGGACAAAGGTGTTACTCACACACTTCAGTGTTTCCATGAC
GGTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCAGAAGAGGTGGGAAAACCACAGCCATGGCCCTGACATTCCAATCC
TCTGATGGGGACTCAGTTGTTTATTTTCGTTCAGGCATCGGCTGATATTCCATTCTCAAAGGACATGCCCTCCACCCCAT
GTCTACCCTGTGTTGTTTTATGTGAGTAATCTTACAGTATTAAAATCTAGTAGGAGTCTCTTACTCAGCACTTGCTCAAA
GTTCTCAGCTGACACTTTTGTTGTAGGGAGACACCTTGTGTTTGCGGGATGGGTCCTTCCTTTAGCCCTGGGCACCAAGG
TGTGATAGCAGCCATAGAAACTTGGAAAGCGAGGAGAATCTTCAGAGCACAGGGAGGGAGGGGTGGCTCCACATCCTCCT
CTCTAAGGCGGTGCCTCCTTCTCCCCAAGGTGGTCAGGACAAGCCCTTGCTGTCTGCCTGGCCAAGCCCTGTGGTGCCTC
CAGGACATGTGATTCTTCAGTGTCATTCTTATCTTGGGTTTAACAACTTCAGTCTGTAAAAGGAAGATGGGGTGCCTGTC
CCTGAGCTCTACAACATAATATTCTGGAACAGCCTTTTCATGGGCCCTGTGACCCCAGCACACGCAGGGACCTATACATG
TCGGGGTTCACAACCACACTACCCCAGTGGGTGGTCGGCACCCAGCAACCCCCTGGAGATCACGGTCACAGGTCAGAGGG
CTCCTGTCTGGGATTCTCCTTGTCCCACCTCCTGAATCCCAGAGCTCCTGGTGGGCGTGTCCTTGCGGGTCCCATCATGC
AAGTCCTGACTGTATTTGGGGTAAAGGGGGATTGAATACAGGGAAATGGGTGCTGTGGTGGAAAGAATAATTGTCCCCAG
TGATGACTACATTCTAATCCCTGGAGTCTGTGACTATTTATGATATAGGGGAAGGGACTGAAGGAGAAGATGGAGCTCAG
GTTGTTGATGAGTTGACCTTGAGATGGGGAGACAGCCTGGACTGTCCTGATGGGCTCAGTGTAGTCACAGGGGTCCACAT
GAAAGGAGGAGGAAGAGGGGAGTGGGGATTACAGCAGCATAATGGGAGTCTCCATCAGCTTTGAAGGTGGAGGAAGTCCA
GGAGCCATGAATGCAGATGGCCTATAGAGGCTGGAAAAGTCAAGTAACTGATTCTCCTGAGTCTCCAGAGGGAACGAAGC
CCTGCAGGTACCTTGATTTTACCCACGACAAACAGGGTCCGATTTCTGTCTCCAGAATTGGAAGGGGTTAGTGTGCTCTC
TCCTGCTGCCATGCTTCTGATAATTTTCTACAGCAGCAACAGGAAACCAACACTGGAACCCAGGTCAAGGACAAGTTAAG
AAACAACACAAGGATAGCCAGGCATGGTGGCAGGTGCATGTAATCCTAGCGACTTGGGAGGCTGAGGGCAGGAGAATCAC
TTGAACCCAGGAGACAGAGGTTGCAGTAAGCCTAGACCACACCACTTCACTCCAGCCTGGGCAAAGGAGTGAGACTCTGT
CGCCAAAATTAATTAATTAATTAAAGAAACCAAACAAGGAGAAGGTTGGCTACACTGAGATCAGCAAGGCTCGGATGATG
ATGCCACCACCAGGCTCCATCCACATAGGGAGGGGTTGATACTCCTCCAACCAGCACCAGGAGCCAGGCTATGGAAGCTG
GCACTGGCATGGCAAGAGTGTCTCCCAGTCCCTACCAGGAACAGGGTGTGTGGCCACTGGTGCCTGCCTTACTGATCAGT
TCATACCTCCTGCCAAGGATTCCAATTCGTCCAAAAGAGATTGAACCAGGCTGCTAAGAGCCTGGATGTGCAGCCTATCC
TGGTTCCTCTTCCACCCCCACATAGACAGCAGGAAAGACATTAGTTCGAAATAGATACAACAGCCCAAGAGATGAGGCTG
AGCCCAGCGGCAAGGGAATCAGAGGCTACTAGAGACAGAGGGACAGAGAAGAGTGAGGGAGACAGATGGAAGGACCTGCA
CCAGGAGTTATGGGCACAGAAAAGAACATGAAGACACAGAGAGGAAGGAGAGAGATAAGACACCAGGAAGGGGAAGCCTG
ACTCAATCCAGGTGCCATGGATGGGATGATAAAGAGAGACACCTTCTAAACTCACAACCTCTCTTCCTAGGAGTCCACAG
AAAACCTTCCCTCCTGGCCCACCCAGGTCGCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCA
TGTTTGAACACTTCCTTCTGCACAGAGAGGGGATGTTTAACGACACTTTGCGCCTCATTGGAGAACACCATGATGGGGTC
TCCAAGGCCAACTTCTCCATCAGTCGCATGACGCAAGACCTGGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTC
CCCCTATCAGGTGTCAGCTCCCAGTGACCCTCTGGACATCGTGATCATAGGTGAGAGTGTCCAGACTTTCTTCTCATTGT
CATTGGGATGCAGAGTGAATGATCCAGGACTTGGAGGCCCAGGTGGCTGTAAGGAAGATGAGCTTGGTATTCTTATGGAG
AGAGACTGACTTGGTGAGGTCTGTGCCAACAGAGACAGAGAAACAGGAGACACAAGTAGAGACCAGGTGTCATAACAGAG
AACAGACACAGGGGCCATACCGGGAGTTTGAAAAGACAGAAAGAGTTAAAGGAGACACACAGACAGACATGTCCCAGAGA
GAGGTGTCCCTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTG
TTCTCTACCAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCACCTAC
AGATGCCATGTTTATTCTGACACCTCTGCCTTCCATGTAATGGAGAGTAATCGTCCCAGGATATCATGGCCCCACAACAC
CAACCCCTGTATGCTGTGTGAACTTGTAGTCTCCAGACTGGATTCTGAGGCTCATATTCCAAATAAGCCCACTTATGAGA
GGATCAGTGAGAGGCACAGAGAGAAATCAGGGACACCAAAAAGCAAAGACATAAACACACAGAGAATGAGCCAGAGGAAG
GAGATTGAGAGACTCACAGACACATAAAGAGAGAGAAAAGAGGGCAGAGAAGTGAGAATGATGGAAGGGAGCAGAGAAAA
GCACTAAAATTAGACTCCTGAGGGAGAGGCACAAGGACATTGAAAGATGGAGATGTGGGGATGAATTGCAGAGATTCCAA
AGAGAACTAGAGAGACCGAGAGGCAGAGCAAGACAGATGATAGATGGATAGATATAGATAGATGATAAATAGGTAGATGA
TAGATACTAGGTTATAGATACATAGATGATGATTGATTGATTCATTAATAGATGAGACATAGAGATGATGATGATGAAGA
CAGATAGATAGATAATACATAGAGATACAGAGGCAGACATAGAGAAATCATAGAGAGAGAGAGATGATACATAGATATAG
ATAATAGATGATTGATGGATAGATAGACAATTGATGGATAAATAGATGATATATAGATATAGATGACAGGTAGAGAATTT
GTAGATAGGCACCGAATAGATAAATAGATAGATCGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACAGGACACA
AAGTGAGAAACTCAGAATTAAAAAAAGTAACATCAAGTCAACCAATCCAAGGACACTCAGAGAGAATAAAACAATCCAAA
AAGAGAAAACATATCTAGAGGTGGGGAAGTGAGGTCAGAGACCTAGAGAGACAGAGAAGGTGGAAGGAGGAAATAGACAT
GAAGAGCGATGGGGTAGAGGGTGAGAGAGAGAGAGAGAGAGCATTAGGTCATAGAACAGGGGAGTGAGTTCTCAGCTCAG
GTGAAGGGAGCTGTGACAAGGAAGATCCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTTCTC
TCTCAGCCCAGCCGGGCCCCACGGTTCTGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATG
TACCATCTATCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGGGACCAAGGTCAACGGAACATTCCAGGCCAA
CTTTCCTCTGGGCCCTGCCACCCATGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGACTCTCCATACGAGTGGTCAA
AGTCAAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAGCCCATGGCTGTCCCATGTCCTATGATCCTAGAGCCTT
AGCTGAGGGGCTTCCTGCTGATGATGGAGAGAAGCATGGACAGATGCAGAGAGAAGACGCAGCCTCGGTGTGAGGGAGGG
ATCAGGGCACAGGATGGCCGACAGGGCACCTCCAAACCCTCCTACATGGCCTGCATGGAGGCCCACGGCCAGGGCTCCAG
GCACCCAGGCAGATGGAGAAAGCGGTCAGGAGAGACCCAGAGGAGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGTTC
CCTCAGCCCCTCAACCTTACCCATTTCCCAGAAGCCCATCCTGGCCTCTCACCCACACAGAGATGTCATCACCAGCAACC
CCTACACCCTTTACTTTTCTTTGAAGAAATATTTATTGAGGATAAATATACCTATATAGCTTACCACTTTTAACATTTTT
TTTTGAGGTGGAGTCTAGCTGTGTCCCCTATGCTGGAGTGCAGTGGCACAATCTCAGCTCACTGCAACCTCCACCTCCTG
GGTTCAAGCGATTCTCCTGCCTCAGCCACCTGAGTAGCTGGTGCTACAGGCACGCACCACCACGCCAGGCTACTTTTTGT
ATTTTTAGTAGGGAGGTGGTTTCACCATGTTGGTCGAGCTGGTCTCGAACTCCTGACCAAGTGATCCACCCGCATCTGCC
TCCCAAAGTGCTGGGATTACAGGCATGGGCCACCGCGCCCAGCCACATTTACCATTTTTAAGTGTAAAGTCTAGTGGTCA
TAAATACATTTATATACATATATATATATATACATTTTTTTTACCCTCCACCCTTTTCTTCCTGTCCTCCAGTAGCCACC
ATTCTACTCTCTACCTTCATGAGATCCACCTTTTAGCTCCTGTATATGGGTGAGAAATGGGAATCTTTGTAATGACCTCC
AGTTCCATCCATGTGGCTGCAAATGACAGGATGTTATTCTTTCTATGGATGAGTAGTCTCCACTATGCGTATGTACTACA
TTCTCTCTATCCATTTACCCACTGATGGGCAGGTAGGTTGACTCCTCATCTTGGCTACTGTGAACAGTGCTGCACCAATC
ATACGAGTGCAGATATCACTTCGATATATTGATTTACTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGATACTA
TGAAAGTTCTCTTTTTTTCTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGCCCAAGCTGGAGTCAAAGTGGTGCG
ACCTTGGCTCATTGCAACCTACGCCTCCTGGGTTCAAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCTGGGATTACAGG
TGCACACCACCATGCCTGGCTACTTTTTGGTTTTTTTAGTATAGATGGGGTTTCCCCATGTTGGCTGGGCTGCTCTCAAA
CTCATGACCTCAACTGAGGTGCCCGCCTCAGTCTCCCAAAGTGCCGGGATTACAGGCATGATCCACCGCACCCAACCTCT
TTTTAGTTCTTTAAAGGACTTCCATACTTTTCTCCGTAATGGCTGTACTAATTTACACTCCTCCCAACAGGGTACCAGGG
TTCTCCTTTCTCTACCACCTTGCCAGCATTTCTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTTATTTCATTTTAT
TTTGAGATGGAGTTTTGCTCTTCTCACCCAGGCTGGAGTGCAGTGGCGCGATCTCGGCTCACCACAACCTCCACCTCCCA
GGTTCAAGCGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGAATTACAGGCACACGCCACCACGCCCGACTAATTTTTGT
ATTTTTAGTAGAGACAGCGTTTCTCCATGTGGGTCATACTGGTCTCAAACTCCCGACCTTATGAGATTCACCCACCTCAG
GCTCTCAAAGTTCTAGGATGACAAACGTGAGCCACCTCACCCGGCCTAAAAGCCATTTTAATGGGGTGAGATGAAAACTC
ACTTTGAATTTAATTTGCGTTTCTCTGATGATGAGTGATACTGAGCAGTTTTTCGTATGTGGGGAAATTTCATGTCTTTT
GCTCCTTTTTCAATTAAATCATTTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCTAGTTATTAATCCCATCTCAGAT
GCATAGTTTGCACATATTTGCTCCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCGGTGCAGAAGTTG
CTTAGTATGAGGTAATCCCAATGGTCTATTTTTGCTTCGATTACTTGTGTTTTCAAGGTTTAAAACAAAATGTCTTTCTT
CAGACAAGTGTCCTGGAGCATTTCCCCAATATTTTGTTCTACGTGTTTCATAGGTTCAGGCCTTAGACTCACATCTTTAA
TCCATTTTCATTTGATTTTTGTGTATGGTGACAGGTAGAGGTGCAGTTTCATTCCTCTGCATGTAGATGTCCAGGTTTCC
CTGCACTGTTTATTGAAAAGACTGTCCTTTCCTGATTGTGAGTTCTTGGCATCTTTGTCAAAGTCCATTGGATGGGCTGG
GCTTGGTGGCTAACACCTGCAATTTCAGCACTTTGGGAGCCCGAGGTGGGTGGATCACCTGAGGCCAGGAGTTCAAGATT
AGTCTGGCCGACGTGATGAAACATCATCTCCACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCACCTGTAATAC
CACTACTCAGGAGTTTGAGGCAAGAGAATGATTGAACCCAGGAGGCTGAGGTTGCAGTGAACCGAGATTGCACCTTTGCA
CTCCAGCCTGAGTGACAGAGCAAGACTCCATCTCAAAAGAAAAAATAAAAAACCATTGGATGTAAATGCATGGAATATAT
CTGTGTTATTCATTCTGCTCCGTTGTTCTATGTGCCTTTCTTTATGCCAGTGTCATGCTATTTTGCTTACTACAGCTCTG
TAACATATTTTGAGATCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTGAAGTCTCAAGACAGTGGGTGTCACAT
AAAAAAATTATGGAAAAAAGGATCCCAGGACTCCCAGGGCCCAATATTAGATAACAGAGTGTTGGCCATGAACCATCCTC
AAAGATTTCCACTGAGTGGAGGACAGAAACCCTCATTTCCTCACCTCTCTCCTGTCTCATGTTCTAGGAAACCCTTCAAA
TAGTTGGCCTTCACCCACTGAACCAAGCTCCGAAACCGGTGAGTACAGAACCCTCTTATATCCGCTTTTGGAAACCTGGG
GAGGTGGAAACCTTGGATTCAGGCGTTGACTCAGCATCTCACAGCTCTGACATTGTACCCCTGTCTTCCACCATCTCTGA
ACTCCAGATACTCCTACAGCGAAAGGGATCTGGGCCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTCATTTTATGGA
GCTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAATGTTTGTTCTGCCTG
CATTCCTAACTGGAGGATAAATTCCTGGAGACTTGAGAGAGGAAAGGGAAGGGAACATCTGATGAGGGCGAGGTGTTTTA
GAGAAGTTCCACTTGCCAAGGAATGAGCTCCTGTAGGTCATGAAGCAACCCTGGCTGACTCAGCAGAGCAAGAGCCTTGC
CGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTCAGGCTGTGCA
GTGCGGAACCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTTTTTAATTATC
TTACAGTGCTGTAGCTCAAAGTAGGAAGTGCATCTTACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCTTCCCTCTGA
GGATTCCAGGCACGAATCTGCTTCTCACTTGTCCCAGCTTCTAAAGGCTCCCAGTTCCTTGGCTCCTGGTCCCCTTCCTC
CTTCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGTGCCTTCTTCCTTACCACACTTCTTTCTCT
GAATGCTGCTCTCCCTTCTTCCTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCCTCATAA
TCTCCTGGAAATCATCCAGGATACCCTTGTTTTAAGTTCAGCTGATTAGTAACCATAATTCCATCTGCAATCTTCATTCC
TCCTTTCCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGCATTCTCCTG
CCTTCCACAAACAGTGAACAAGATGCATTTGGCCTCTGCCCTTGGGACACTGATATTGCAGATGGTTAAATGGGAGGGCA
GAAAATGAATGCACAAGTGGATCTATAAATGAATGATCCATTGGGAAGCATCTGTGCGTGAAATCTATTTTTTGTTTGTT
CTTTTGTTTATTGAGACAGAGTCGCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACCATCTTGGCTCACTGCAACCTGC
GTCTCCTGGATTCAAGTGATTCTCCTGCCTCCGCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCGTGCCCGGCTA
ATTCTTTTTGTATATTTTTTGTAGAGAGGATGTTTCACCACGTTGGCCAAGCTTGTCTGAAACTCCCAACCTCAAGTGAT
CCGACCGTCTCAGCATGCCAAAGTAATGAGACTACAGGCGTGAGCCACTGTGCCCAGCCAGAATTCAAAATCAATAATAG
ATAATGCTGAGTGTATGATTTCAGGTGACAAAGAAGGTCTCACTATTCAGATATTTGTGACATTAATGAAAAACACGGAT
TGAACCCCTGAAAGATTGGCGGAAGGATTTTGCACACACAGCTGTCAGCCGTGAAGGCACAAAGGTGAAAACAATCTGAT
GTGGAAGGAAGAGGCTCTGCCTCAAATGCTGGGAATGATGTGGGGAGAATGACAAGACGACTGTGGAGAGACGGAGAGCA
CACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGCGTGTGTTTGACACTCACAGCCATTGGATTCACCTCGAGGTAAC
CAGGAATCCCTACATGATTAATAGTGACTGACATGAAAATAAGGGAGGCTCAGTTGCGTAACTGGAATCTAGGAGACCGT
GGAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGATGGATATAAGAT
AGGTTTGTGAGGTAGAATCATTGACTGGAAAGGCTTGCTGGGTTTGATTTTCCTACTTGTTTAATCCTCGCTTAATTAAT
TTCTTTCTGAGATTTATTCATCCTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGGTGGTGGAAAT
GAAGGGACCTATTATAGCATAATATACAAGTCTCTGAACGGTGGCTCACGCCTGTAACCCAGCACTGCAGGAGGCCAAGG
CGGGTGGATCACATGAAGTCAGCAGTTCCAGACCAGCCTGGCCAACATGGTGAAACCCTGTCTCTAGGAAAAACACAAAA
ATTAGCCGAGCATGGTGGTGCATCCCTGTAATCCCAGCTCCTACTCTGGAGGATGAAGCAGGAGAATGACTTCAACCCAG
GAGGTGGAGGTTGCAGTGAGTGGAGGTTGCATCACTGCACTCCAGCCTGGGTGGCACAAGGAGACTCCGTCTCAAAAAAT
AAAAATAAGAAATGCATAAATATAAATATAATATAACACACGCAAATGACAAAGGGACCTGAATTCCAATCATGATTTTT
CTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATGAGCCTAAAACCTCTTCCCTATTTGGCTT
TCTGTGAGCATGAGATCATATAGAAAATGTGAAAGTCCGCTGAATCCTCCAGCACAGATCCTGGAATAGAGAAAGTGCTC
TGGTCATCACAAAAAAAACTTGCCCACTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCACCTGTGGAGATTCAGA
TAGACCATGGGGAGGTAAACATTAACACTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATCAGCGACAGCACTAGCT
CCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTTTTGAAGCAATAGATGGCCGAGGGGGTGGTCCTTCCCCC
AGCCTCTCAGGTAGAACAGCAGCCTAATATGTGTCTCCCGAGATCACAAAGAGCAGCAGGTTTCACACGGGCTTCAACAC
TATTTCCTGGCCGTTTGACATAAGAGAATTCTATTTCGCTTTTTTTATCTTGATTTCACTTTTGTTTTCTTTCCTTGGAG
AATGCAAGTTGTTTGACTCAAGAATGCTGTGGATGTAGAAACCCTAAAGCACATTCGCTGTGAATCAATCCCAGTCCAGC
CTTCCCAGAGAAGACTCTAAACACCTCCTGGACTGCACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTCCAGGG
AGACAGAACACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAACCTATA
TTTCAATGTGACCCAGTCCCTCAAGGCTCAGAAAAGCTCCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAGCTGCG
GGAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTAACCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCC
TCCAGGAAGAACAGGAAGACAGCCCAGGGTGTTCTGAGACGTTCCTCCTGATCTCAGGAAGTTGCTGTCTTAGTCCATTT
TTGTTGCTCTAAAGGAACACTTGAGCCTCGGTAACTTCTAAAGAAAAGAGATTGGTTTGCCTCACCGTTCTGCAGGCTGT
ACTGGAAGCATGGCACCAGCATCTATTTCTCGTGATGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGTCTG
TCTGTGCAGAGACCACAGAGATCACACGGCAAGAGAGGGAGCAAGGGGGAGGGGGAGCGATGGAGCTTCCAAGCTCTTTT
TAACAACCAGCTCTCCGGGAACTAATAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGATGTGTTCATGA
TGGATCCACCTCCATGACCCAAACACCTCTCAAGAGGCCCAACCTCCCACAGTGGGGGTGAAATTTCAATGTGAGGTTTG
AAGGGGTCAAACATCTCAACTAAAGTAGTCGTATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAACTGAAAAAGC
AGGAGAAAGCTGGGTCTCCTGCCATCTGGGTGCTTGTCCTAAAGAGGTGTTTTATGTGGTTACCTGTCAATCAAGAAATG
CGAGACAATTCATAAAGAGGAACTGCTAAGATTAGCTTCTTATTGGTGTCTCATCTTCTTCCAGGTAACCCCCGACACCT
GCACATTCTGATTGGGACCTCAGTGGTCATCATCCTCTTCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCTCCAACA
AAAAAAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCACTCAGGTGTGTG
TTCCTCACTAACAGGATGGTCCCTGGCCCAAGGCAGCAGCCACAGAGGCAGGACTTTCTAGAGAGGGCACCAGACTCCCT
GCCCCTGCCTTCAGCTCACAGACCGTTGCCTGATTCTGAACTGTATCCTCATGTCCCCTGCAGCCACTCACATCCAGGAG
AAGGTTCCATGACAGGCAGAAAGTGGGAGACAGAATCAATGGGATGGGAACTCAGAGCTATTCATGGGATGGGTCCTTGA
GCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGCCACCTATGGTCTCCCCCTGTATGTTGG
TATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTGTTTTGTTGACTTCCATCTCCTACAGATGCTGCGGTAA
TGGACCAAGAGTCTGCAGGAAACAGAACAGCGAATAGCGAGGTAGGTGCTCCTCGGCCCGGGCTCGTGGCTACTGTTATT
CCCAAAGAGTCCTGGAAAATGTGAGCACCCTCCCTCACTCAGGATTTCCCTCTCTCCAGGACTCTGATGAACAAGACCCT
CAGGAGGTGACATACACACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGAC
ACCCCCAACAGATATCATCGTGTACACGGAACTTCCAAATGCTGAGTCCAGATCCAAAGTTGTCTCCTGCCCATGAGCAC
CACAGTCAGGCCTTGAGGGCGTCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATGTACCAGC
AGCTGGAATCTGAAGGCATGAGTCTGCATCTTAGGGCATCGCTCTTCCTCACACCACAAATCTGAATGTGCCTCTCACTT
GCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAAAAAACACACTCCTTTGCTTAGCCCACAGTTCTCCATTTCAC
TTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTACTTGAGGCTGCAATCACACTGAGGAACTCACA
ATTCCACACATACAAGAGGCTCCGTCTTAACGCAGCACTTAGACACGTGCTGTTCCACCTTCCCTCATGCTGTTCCACCT
CCCCTCAGACTAGCTTTCAGCCTTCTGTCAGCAGTAAAACTTATATATTTTTTAAAATAACTTCAATGTAGTTTTCCATC
CTTCAAATAAACATGTCTGCCCTCAT

IPD-KIR