Allele Report for 2DL1*007


2DL1*007
Previous Designations & Local Names: GU2015
IPD Acc No: KIR00200
Assigned: 31-OCT-2006 Sequence Last Modified: 21-MAY-2010
Source Entries: DQ466577 , GQ406043 , GU182351  
Cells Sequence Derived From: G248 , GM17178 , GU2015  
Known Ethnic Origin Of Source: Black
Publications
Hou L et al. Tissue Antigens 69:250-4 2007. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 2
Protein Sequence (348 aa)
MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGV
SKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDVVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHL
SREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGN
PRHLHILIGTSVVIILFILLFFLLHCWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQ
RPKTPPTDIIVYTELPNAESRSKVVSCP
Nucleotide Sequence Data (1047 bps)
ATGTCGCTCTTGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACATGAGGGAGTCCACAG
AAAACCTTCCCTCCTGGCCCACCCAGGTCGCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCA
TGTTTGAACACTTCCTTCTGCACAGAGAGGGGATGTTTAACGACACTTTGCGCCTCATTGGAGAACACCATGATGGGGTC
TCCAAGGCCAACTTCTCCATCAGTCGCATGACGCAAGACCTGGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTC
CCCCTATCAGGTGTCAGCTCCCAGTGACCCTCTGGACGTCGTGATCATAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTCTGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTA
TCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGGGACCAAGGTCAACGGAACATTCCAGGCCAACTTTCCTCT
GGGCCCTGCCACCCATGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGACTCTCCATACGAGTGGTCAAAGTCAAGTG
ACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCGAAACCGGTAAC
CCCCGACACCTGCACATTCTGATTGGGACCTCAGTGGTCATCATCCTCTTCATCCTCCTCTTCTTTCTCCTTCATTGCTG
GTGCTCCAACAAAAAAAATGCTGCGGTAATGGACCAAGAGTCTGCAGGAAACAGAACAGCGAATAGCGAGGACTCTGATG
AACAAGACCCTCAGGAGGTGACATACACACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAG
AGGCCCAAGACACCCCCAACAGATATCATCGTGTACACGGAACTTCCAAATGCTGAGTCCAGATCCAAAGTTGTCTCCTG
CCCATGA
Genomic Sequence Data (14749 bps)
GTTCGGGAGGTTGGATCTCAGACGTGTTTTGAGTTGGTCATAGTGAAGGACACTAGGTGTCAAATTCTAGCGAGAACAAT
TTCCAGGAAGCCGTGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCC
TCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTCGGTC
GCGGCTGCCTGTCTGCTCCGGCAGCACCATGTCGCTCTTGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAAGCAA
TAGAGGGAGGGAGCGCGGGGATGGAGATCTGGGCCCAGAGGTGGAGATATAGGCCTGGAGGTGGAGTTATGGGCCTGGAG
TGGAGATCTGGGCCTGGAGTGGATATATGGGCCTAGAGATGGAGTGATGGGCCTAGAAGTGGAGATCTGGGCCCAGAGGT
CGAGATATAGGCCTGGAGGTGGAGTGATGGGACTGTAGTGGAGATCTGGGCCTGGAGTGGAGATAGGAACCTGGAGGGGA
GATAGGAACCTGGAGGGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGTCATGGGCCTGGAGGTGGAGT
TACGGGCCTGCAGTAGAGATATGGGCCTGAAGTGGAGACATGGGCCTGGAGTGGAGATATGGGCCAGGAGTGGAGATATG
GGCCTAGAGGTCGATATCTGGGCCTGGAGTGGAGATATGGGCCAGGAGTGGAGATATGGGCCTAGAGGTCGATATCTGGG
CCTGGAGAGGAGATATGTGCCTAGGATGGAGATACGGGCCTGGGTGTGGAGATATGGGACTGGAGAGGATATATGGGCCT
GGAGTGGAGATATGGGACTGGAGAGGAGATATGGACCTGGAGTGGAGATAAGGGCCTGGATTGGAGATATGGGCCCAGGG
TGGAGATCTGAGCCTGGATTGGAGATATGGGCCTGGATTGGCGATATGGGCTTAGGGTGGAAATATCGGCCTGGAGTGGA
GATATGGGCCTGGAGTGGAGATATGGGCTTGAGGTGGGGATATGGACCTGGAGGCTGGGTCTCTGCACAGCCGACAGCCC
TGTTCTTGGGTGCAGGTAGGCACTGAGGGTGAGTTTACCTTCAGCCCAGGAAGGGCCTGGCTACCAAGACTCACAGCCCA
GTGGGGGCAGCAAGGGTGCCCTGGTTTGCCTGCAGATGGGTCATCCATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTG
CAGGGGGCCTGGCCACATGAGGGTGAGTCCTTCTCCAAACCTTCGGGTGTCAATCTCCCCACATAAGAGGATTTTCCTGA
AATGGGAGGGAAGTCCTGTCAGGGAGTCTCTCATAAACTAGGAAGAAGGGACCCTGGGGTGCTGGGCCCACATTTCTGAC
CTTGCCTCCCTGGCCTTTCATTCCCTTGGCAGAGTCAAGTTCTGTGGGGACCAGGGTTAGACTACGGTGCTCAAAGCTGG
GGTGTGTGGTGGGGAAGTGGTAGGAACAGCAGATCCTCTGAGGACAAAGGTGTTACTCACACACTTCAGCGTTTCCATGA
CGGTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCAGAAGAGGTGGGAAAACCACAGCCATGGCCCTGACATTCCAATC
CTCTGATGGGGACTCAGTTGTTTATTTTCGTTCAGGCATCAGCTGATATTCCATTCTCAAAGGACATGCCCTCCACCCCA
TGTCTACCCTGTGTTGTTTTATGTGAGTAATCTTACAGTATTAAAATCTAGTAGGAGTCTCTTACTCAGCACTTGCTCAA
AGTTCTCAGCTGACACTTTTGTTGTAGGGAGACACCTTGTGTTTGCGGGATGGGTCCTTCCTTTAGCCCTAGGCACCAAG
GTGTGATAGCAGCCATAGAAACTTGGAAAGCGAGGAGAATCTTCAGAGCACAGGGAGGGAGGGGTGGCTCCACATCCTCC
TCTCTAAGGCGGTGCCTCCTTCTCCCCAAGGTGGTCAGGACAAGCCCTTGCTGTCTGCCTGGCCAAGCCCTGTGGTGCCT
CCAGGACATGTGATTCTTCAGTGTCATTCTTATCTTGGGTTTAACAACTTCAGTCTGTAAAAGGAAGATGGGGTGCCTGT
CCCTGAGCTCTACAACATAATATTCTGGAACAGCCTTTTCATGGGCCCTGTGACCCCAGCACACGCAGGGACCTATACAT
GTCGGGGTTCACAACCACACTACCCCAGTGGGTGGTCGGCACCCAGCAACCCCCTGGAGATCACGGTCACAGGTCAGAGG
GCTCCTGTCTGGGATTCTCCTTGTCCCACCTCCTGAATCCCAGAGCTCCTGGTGGGCGTGTCCTTGCGGGTCCCATCATG
CAAGTCCTGACTGTATTTGGGGTAAAGGGGGATTGAATACAGGGAAATGGGTGCTGTGGTGGGAAGCACTGTGTTGTCCC
CAGTGATGACTACATTCTAATCCCTGGAGTCTGTGACTATTTATGATATAGGGGAAGGGACTGAAGGAGAAGATGGAGCT
CAGGTTGTTGATGAGTTGACCTTGAGATGGGGAGAAGGCCTGGACTGTCCTGATGGGCTCAGTGTAGTCACAGGGGTCCA
CATGAAAGGAGGAGGAAGAGGGGAGTGGGGATTACAGCAGCATAATGGGAGTCTCCATCAGCTTTGAAGGTGGAGGAAGT
CCAGGAGCCATGAATGCAGGTGGCCTATAGAGGCTGGAAAAGTCAAGGAACTGATTCTCCTGAGTCTCCAGAGGGAACGA
AGCCCTGCAGGTACCTTGATTTTACCCACGACAAACAGGGTCCGATTTCTGTCTCCAGAATTGGAAGGGGTTAGTGTGCT
CTCTCCTGCTGCCATGCTTCTGATAATTTTCTACAGCAGCAACAGGAAACCAACACTGGAACCCAGGTCAAGGACAGGTT
AAGAAACAACACAAGGATAGCCAGGCATGGTGGCAGGTGCATGTAATCCTAGCGACTTGGGAGGCTGAGGGCAGGAGAAT
CACTTGAACCCAGGAGACAGAGGTTGCAGTAAGCCTAGACCACACCACTTCACTCCAGCCTGGGCAAAGGAGTGAGACTC
TGTCGCCAAAATTAATTAATTAATTAAAGAAACCAAACAAGGAGAAGGTTGGCTACACTGAGATCAGCAAGGCTCGGATG
ATGATGCCACCACCAGGCTCCATCCACATAGGGAGCGGTTGATACTCCTCCAACCAGCACCAGGAGCCAGGCTATGGAAG
CTGGCACTGGCATGGCAAGAGTGTCTCCCAGTCCCTACCAGGAACAGGGTGTGTGGCCACTGGTGCCTGCCTTACTGATC
AGTTCATACCTCCTGCCAAGGATTCCAATTCGTCCAAAAGAGATTGAACCAGGCTGCTAAGAGCCTGGATGTGCAGCCTA
TCCTGGTTCCTCTTCCACCCCCACACAGACAGCAGGAAAGACATTAGTTCGAAATAGATACAACAGCCCAAGAGATGAGG
CTGAGCCCAGCGGCAAGGGAATCAGAGGCTACTAGAGACAGAGGGACAGAGAAGAGTGAGGGAGACAGATGGAAGGACCT
GCACCAGGAGTTATGGGCACAGAAAAGAACATGAAGACACAGAGAGGAAGGAGAGAGATAAGACACCAGGAAGGGGAAGC
CTCACTCAATCCAGGTGCCATGGATGGGATGATAAAGAGAGACACCTTCTAAACTCACAACCTCTCTTCCTAGGAGTCCA
CAGAAAACCTTCCCTCCTGGCCCACCCAGGTCGCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATG
TCATGTTTGAACACTTCCTTCTGCACAGAGAGGGGATGTTTAACGACACTTTGCGCCTCATTGGAGAACACCATGATGGG
GTCTCCAAGGCCAACTTCTCCATCAGTCGCATGACGCAAGACCTGGCAGGGACCTACAGATGCTACGGTTCTGTTACTCA
CTCCCCCTATCAGGTGTCAGCTCCCAGTGACCCTCTGGACGTCGTGATCATAGGTGAGAGTGTCCAGACTTTCTTCTCAT
TGTCATTGGGATGCAGAGTGAATGATCCAGGACTTGGAGGCCCAGGTGGCTGTAAGGAAGATGAGCTTGGTATTCTTATG
GAGAGAGACTGACTTGGTGAGGTCTGTGCCAACAGAGACAGAGAAACAGGAGACACAAGTAGAGACCAGGTGTCATAACA
GAGAACAGACACAGGGGCCATACCGGGAGTTTGAAAAGACAGAAAGAGTTAAAGGAGACACACAGACAGACATGTCCCAG
AGAGAGGTGTCCCTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAA
GTGTTCTCTACCAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCACC
TACAGATGCCATGTTTATTCTGACACCTCTGCCTTCCATGTAATGGAGAGTAATCGTCCCAGGATATCATGGCCCCACAA
CACCAACCCCTGTATGCTGTGTGAACTTGTAGTCTCCAGACTGGATTCTGAGGCTCATATTCCAAATAAGCCCACTTATG
AGAGGATCAGTGAGAGGCACAGAGAGAAATCAGGGACACCAAAAAGCAAAGACATAAACACACAGAGAATGAGCCAGAGG
AAGGAGATTGAGCGACTCACAGACACATAAAGAGAGAGAAAAGAGGGCAGAGAAGTGAGAATGATGGAAGGGAGCAGAGA
AAATCACTAAAGTTAGACTCCTGAGGGAGAGGCACAAGGACATTGAAAGATGGAGATGTGGGGATGAATTGCAGAGATTC
CAAAGAGAACTAGAGAGACCGAGAGGCAGAGCAAGACAGATGATAGATGGATAGATATAGATAGATGATAAATAGGTAGA
TGATAGATAATAGGTTATAGATACATAGATGATGATTGATTGATTCATTAATAGATGAGACATAGAGATGATGATGATGA
AGACACATAGATAGATAATACATAGAGATACAGAGGCAGACATAGAGAAATCATAGAGAGAGAGAGATGATACATAGATA
TAGATAATAGATGATTGATGGATAGATAGACAATTGATGGATAAATAGATGATATATAGATATAGATGACAGGTAGAGAA
TTTGTAGATAGGCACCGAATAGATAAATAGATAGATCGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACAGGAC
ACAAAGTGAGAAACTCAGAATTAAAAAAAGTAACATCAAGTCAACCAATCCAAGGAGAGTCAGAGAGAATAAAACAATCC
AAAAAGAGAAAACATATCTAGAGGTGGGGAAGTGAGGTCAGAGACCTAGAGAGACAGAGAAGGTGGAAGGAGGAAATAGA
CATGAAGAGCGATGGGGTAGAGGGTGAGAGAGAGAGAGAGAGAGCATTAGGTCATAGAACAGGGGAGTGAGTTCTCAGCT
CAGGTGAAGGGAGCTGTGACAAGGAAGATCCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTT
CTCTCTCAGCCCAGCCGGGCCCCACGGTTCTGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGAC
ATGTACCATCTATCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGGGACCAAGGTCAACGGAACATTCCAGGC
CAACTTTCCTCTGGGCCCTGCCACCCATGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGACTCTCCATACGAGTGGT
CAAAGTCAAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAGCCCATGGCTGTCCCATGTCCTATGATCCTAGAGC
CTTAGCTGAGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGACAGATGCAGAGAGAAGACGCAGCCTCGGTGTGAGGGA
GGGATCAGGGCACAGGATGGCCGACAGGGCACCTCCAAACCCTCCTACATGGCCTGCATGGAGGCCCACGGCCAGGGCTC
CAGGCACCCAGGCAGATGGAGAAAGCGGTCAGGAGAGACCCAGAGGAGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGG
TTCCCTCAGCCCCTCAACCTTACCCATTTCCCAGAAGCCCATCCTGGCCTCTCACCCACACAGAGATGTCATCACCAGCA
ACCCCTACACCCTTTACTTTTCTTTGAAGAAATATTTATTGAGGATAAATATACCTATATAGCTTACCACTTTTAACATT
TTTTTTTGAGGTGGAGTCTAGCTGTGTCCCCTATGCTGGAGTGCAGTGGCACAATCTCAGCTCACTGCAACCTCCACCTC
CTGGGTTCAAGCGATTCTCCTGCCTCAGCCACCTGAGTAGCTGGTGCTACAGGCACGCACCACCACGCCAGGCTACTTTT
TGTATTTTTAGTAGGGAGGTGGTTTCACCATGTTGGTCGAGCTGGTCTCGAACTCCTGACCAAGTGATCCACCCGCATCT
GCCTCCCAAAGTGCTGGGATTACAGGCATGGGCCACCGCGCCCAGCCACATTTACCATTTTTAAGTGTAAAGTCTAGTGG
TCATAAATACATTTATATACATATATATATATACATTTTTTTTACCCTCCACCCTTTTCTTCCTGTCCTCCAGTAGCCAC
CATTCTACTCTCTACCTTCATGAGATCCACCTTTTAGCTCCTGTATATGGGTGAGAAATGGGAATCTTTGTAATGACCTC
CAGTTCCATCCATGTGGCTGCAAATGACAGGATGTTATTCTTTCTATGGATGAGTAGTCTCCACTATGCGTATGTACTAC
ATTCTCTCTATCCATTTACCCACTGATGGGCAGGTAGGTTGACTCCTCATCTTGGCTACTGTGAACAGTGCTGCACCAAT
CATACGAGTGCAGATATCACTTCGATATATTGATTTACTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGATACT
ATGAAAGTTCTCTTTTTTTCTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGCCCAAGCTGGAGTCAAAGTGGTGC
GACCTTGGCTCATTGCAACCTACGCCTCCTGGGTTCAAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCTGGGATTACAG
GTGCACACCACCATCCCTGGCTACTTTTTGGTTTTTTTAGTATAGATGGGGTTTCCCCATGTTGGCTGGGCTGCTCTCAA
ACTCATGACCTCAACTGAGGTGCCCGCCTCAGTCTCCCAAAGTGCCGGGATTACAGGCATGATCCACCGCACCCAACCTC
TTTTTAGTTCTTTAAAGGACTTCCATACTTTTCTCCGTAATGGCTGTACTAATTTACACTCCTCCCAACAGGGTACCAGG
GTTCTCCTTTCTCTACCACCTTGCCAGCATTTCTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTTATTTCATTTTA
TTTTGAGATGGAGTTTTGCTCTTCTCACCCAGGCTGGAGTGCAGTGGCGCGATCTCGGCTCACCACAACCTCCACCTCCC
AGGTTCAAGCGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGAATTACAGGCACACGCCACCACGCCCGACTAATTTTTG
TATTTTTAGTAGAGACAGCGTTTCTCTATGTGGGTCATACTGGTCTCAAACTCCCGACCTTATGAGATTCACCCACCTCA
GGCTCTCAAAGTTCTAGGATGACAAACGTGAGCCACCTCACCCGGCCTAAAAGCCATTTTAATGGGGTGAGATGAAAACT
CACTTTGAATTTAATTTGCGTTTCTCTGATGATGAGTGATACTGAGCAGTTTTTCGTATGTGGGGAAATTTCATGTCTTT
TGCTCCTTTTTCAATTAAATCATTTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCTAGTTATTAATCCCATCTCAGA
TGCATAGTTTGCACATATTTGCTCCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCGGTGCAGAAGTT
GCTTAGTATGAGGTAATCCCAATGGTCTATTTTTGCTTCGATTACTTGTGTTTTCAAGGTTTAAAACAAAATGTCTTTCT
TCAGACAAGTGTCCTGGAGCATTTCCCCAATATTTTGTTCTACGTGTTTCATAGGTTCAGGCCTTAGACTCACATCTTTA
ATCCATTTTCATTTGATTTTTGTGTATGGTGACAGGTAGAGGTGCAGTTTCATTCCTCTGCATGTAGATGTCCAGGTTTC
CCTGCACTGTTTATTGAAAAGACTGTCCTTTCCTGATTGTGAGTTCTTGGCATCTTTGTCAAAGTCCATTGGATGGGCTG
GGCTTGGTGGCTAACACCTGCAATTTCAGCACTTTGGGAGCCCAAGGTGGGTGGATCACCTGAGGCCAGGAGTTCAAGAT
TAGTCTGGCCGACGTGATGAAACATCATCTCCACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCACCTGTAATA
CCACTACTCAGGAGTTTGAGGCAAGAGAATGATTGAACCCAGGAGGCTGAGGTTGCAGTGAACCGAGATTGCACCTTTGC
ACTCCAGCCTGAGTGACAGAGCAAGACTCCATCTCAAAAGAAAAAATAAAAAACCATTGGATGTAAATGCATGGAATATA
TCTGTGTTATTCATTCTGCTCCGTTGTTCTATGTGCCTTTCTTTATGCCAATGTCATGCTATTTTGCTTACTACAGCTCT
GTAACATATTTTGAGATCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTGAAGTCTCAAGACAGTGGGTGTCACA
TAAAAAAATTATGGAAAAAAGGATCCCAGGACTCCCAGGGCCCAATATTAGATAACAGAGTGTTGGCCATGAACCATCCT
CAAAGATTTCCACTGAGTGGAGGACAGAAACCCTCATTTCCTCACCTCTCTCCTGTCTCATGTTCTAGGAAACCCTTCAA
ATAGTTGGCCTTCACCCACTGAACCAAGCTCCGAAACCGGTGAGTACAGAACCCTCTTATATCCGCTTTTGGAAACCTGG
GGAGGTGGAAACCTTGGATTCAGGCGTTGACTCAGCATCTCACAGCTCTGACATTGTACACCTGTCTTCCACCATCTCCG
AACTCCAGATACTCCTACAGCGAAAGGGATCTGGGCCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTCATTTTATGG
AGCTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAATGTTTGTTCTGCCT
GCATTCCTAACTGGAGGATAAATTCCTGGAGACTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGCGAGGTGTTTT
AGAGAAGTTCCACTTGCCAAGGAATGAGCTCCTGTAGGTCATGAAGCAACCCTGGCTGACTCAGCAGAGCAAGAGCCTTG
CCGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTCAGGCTGTGC
AGTGCGGAACCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTTTTTAATTAT
CTTACAGTGCTGTAGCTCAAAGTAGGAAGTGCATCTTACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCTTCCCTCTG
AGGATTCCAGGCACGAATCTGCTTCTCACTTGTCCCAGCTTCTAAAGGCTCCCAGTTCCTTGGCTCCTGGTCCCCTTCCT
CCTTCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGTGCCTTCTTCCTTACCACACTTCTTTCTC
TGAATGCTGCTCTCCCTTCTTCCTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCCTCATA
ATCTCCTGGAAATCATCCAGGATACCCTTGTTTTAAGTTCAGCTGATTAGTAACCATAATTCCATCTGCAATCTTCATTC
CTCCTTTCCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGCATTCTCCT
GCCTTCCACAAACAGTGAACAAGATGCATTTGGCCTCTGCCCTTGGGACACTGATATTGCAGATGGTTAAATGGGAGGGC
AGAAAATGAATGCACAAGTGGATCTATAAATGAATGATCCATTGGGAAGCATCTGTGCGTGAAATCTATTTTTTGTTTGT
TCTTTTGTTTATTGAGACAGAGTCGCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCACTGCAACCTG
CGTCTCCTGGATTCAAGTGATTCTCCTGCCTCCGCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCGTGCCCGGCT
AATTCTTTTTGTATATTTTTTGTAGAGAGGATGTTTCACCACGTTGGCCAAGCTTGTCTGAAACTCCCAACCTCAAGTGA
TCCGACCGTCTCAGCATGCCAAAGTAATGGGACTACAGGCGTGAGCCACTGTGCCCAGCCAGAATTCAAAATCAATAATA
GATAATGCTGAGTGTATGATTTCAGGTGACAAAGAAGGTCTCACTATTCAGATATTTGTGACATTAATGAAAAACACGGA
TTGAACCCCTGAAAGATTGGCGGAAGGATTTTGCACACACAGCTGTCAGCCGTGAAGGCACAAAGGTGAAAACAATCTGA
TATGGAAGGAAGAGGCTCTGCCTCAAATGCTGGGAATGATGTGGGGAGAATGACAAGATGACTGTAGAGAGACGGAGAGC
ACACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGAATTCACCTCGGGGTAA
CTAGGAATCCCTACATGATTAATATGACTGACATGAAAATAAGGGAGGCTCAGTTGCATAACTGGAATCTAGGAGACCGT
GGAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGATGGATATAAGAT
ATGTTTGTGAGGTAGAATCATTGACTGGAAACGCTTACTGGGTTTGATTTTCCTACTTGTTTAATCCTCGCTTAATTAAT
TTCTTTCTGAGATTTATTCATCCTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGGTGGTGGAAAT
GAAGGGACCTATTATAGCATAATATACAAGTCTGTGAACGGTGGCTCACGCCTGTAACCCAGCACTGCAGGAGGCCAAGG
CGGGTGGATCACATGAAGTCAGCAGTTCGAGACCAGCCTGGCCAACATGGTGAAACCCTGTCTCTAGGAAAAACACAAAA
ATTAGCCGAGCATGGTGGTGCATCCCTGTAATCCCAGCTCCTACTCTGGAGGATGAAGCAGGAGAATGACTTCAACCCAG
GAGGTGGAGGTTGCAGTGAGTGGAGGTTGCATCACTGCACTCCAGCCTGGGTGGCACAAGGAGACTCCGTCTCAAAAAAT
AAAAATAAGAAATGCATAAATATAAATATAATATAACACACGCAAATGACAAAGGGACCTGAATTCCAATCATGATTTTT
CTATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATGAGCCTAAAACCTCTTCCCTATTTGGCTT
TCTGTGAGCATGAGATCACATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCACAGATCCTGGAATAGAGAAAGTGCTC
TGGTCATCACAAAAAAAACTTGCCCACTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCACCTGTGGAGATTCAGA
TAGACCATGGGGAGGTAAACATTAACACTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATCAGCGACAGCACTAGCT
CCTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTTTTGAAGCAATAGATGGCCGAGGGGGTGGTCCTTCCCCC
AGCCTCTCGGGTAGAACAGCAGCCTAATATGTGTCTCCCGAGATCACAAAGAGCAGCAGGTTTCACACGGGCTTCAACAC
TATTTCCTGGCCGTTTGACATAAGAGAATTCTATTTCGCTTTTTTTATCTTGATTTCACTTTTGTTTTCTTTCCTTGGAG
AATGCAAGTTGTTTGATTCAAGAATGCTGTGGATGTAGAAACCCTAAAGCACATTCGCTGTGAATCAATCCCAGTCCAGT
CTTCCCAGAGAAGACTCTAAACACCTCCTGGACTGCACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTCCAGGG
AGACAGAACACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAACCTATA
TTTCAATGTGAGCCAGTCCCTCAAGGCTCAGAAAAGCTCCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAGCTGCG
GGAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCC
TCCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGAGACGTTCCTCCTGATCTCAGGAAGTTGCTGTCTTAGGCCA
TTTTTGTTGCTCTAAAGGAACACTTGAGCCTCGGTAACTTCTAAAGAAAAGAGATTGGTTTGTCTCACCGTTCTGCAGGC
TGTACTGGAAGCATGGCACCAGCATCTATTTCTCGTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGT
CTGTCTGTGCAGAGACCACAGAGATCACACGGCAAGAGAGGGAGCAAGGGGGAGGGGGAGTGATGGAGCTTCCAAGCTCT
TTTTAACAACCAGCTCTCCGGGAACTAATAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGATGTGTTCA
TGATGGATCCACCTCCATGACCCAAACACCTCTCAAGAGGCCCAACCTCCCACAGTGGGGGTGAAATTTCAATGTGAGGT
TTGAAGGGGTCAAACATCTCAACTAAAGTAGTCGTATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAACTGAAAA
AGCAGGAGAAAGCTGGGTCTCCTGCTATCTGGGTGCTTGTCCTAAAGAGGTGTTTTATGTGGTTACCTGTCAATCAAGAA
ATGCGAGACAATTCATAAAGAGGAACTGCTAAGATTAGCTTCTTATTGGTGTCTCATCTTCTTCCAGGTAACCCCCGACA
CCTGCACATTCTGATTGGGACCTCAGTGGTCATCATCCTCTTCATCCTCCTCTTCTTTCTCCTTCATTGCTGGTGCTCCA
ACAAAAAAAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCACTCAGGTGT
GTGTTCCTCACAAACAGGATGGTCCCTGGCCCAAGGCAGCAGCCACAGAGGCAGGACTTTCTAGAGAGGGCACCAGACTC
CCTGTCCCTGCCTTCAACTCACAGACCGTTGCCTGATTCTGAACTGTATCCTCATGTCCACTGCAGCCACTCACATCCAG
GAGAAGGTTCCATGACAGGCAGAAAGTGGGAGACAGAATCAATGGGATGGGAACTCAGAGCTATTCATGGGATGGGTCCT
TGAGCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGCCACCTATGGTCTCCCCCTGTATGT
TGGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTGTTTTGTTGACTTCCGTCTTCTACAGATGCTGCGG
TAATGGACCAAGAGTCTGCAGGAAACAGAACAGCGAATAGCGAGGTAGGTACTCCTCGGCCCGGGCTCGTGGCTACTGTT
ATTCCCAAAGAGTCCTGGAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGACTCTGATGAACAAGAC
CCTCAGGAGGTGACATACACACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAA
GACACCCCCAACAGATATCATCGTGTACACGGAACTTCCAAATGCTGAGTCCAGATCCAAAGTTGTCTCCTGCCCATGAG
CACCACAGTCAGGCCTTGAGGGCGTCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATGTACC
AGCAGCTGGAATCTGAAGGCATGAGTCTGCATCTTAGGGCATCGCTCTTCCTCACACCACAAATCTGAATGTGCCTCTCA
CTTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAAAAAACACACTCCTTTGCTTAGCCCACAGTTCTCCATTT
CACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTACTTGAGGCTGCAATCACACTGAGGAACTC
ACAATTCCAAACATACAAGAGGCTCCCTCTTAACGCAGCACTTAGACACGTGTTGTTCCACCTTCCCTCATGCTGTTCCA
CCTCCCCTCAGACTAGCTTTCAGTCTTCTGTCAGCAGTAAAACTTATATATTTTTTAAAATAACTTCAATGTAGTTTTCC
ATCCTTCAAATAAACATGTCTGCCCCCAT

IPD-KIR