Allele Report for 2DL1*0040101


2DL1*0040101
Previous Designations & Local Names: 2DL1v
IPD Acc No: KIR00006
Assigned: 28-JUN-2003 Sequence Last Modified: 24-JAN-2005
Source Entries: AF022045 , AF215827 , AY320039 , AY388471 , DQ666831 , GU182339 , GU182347  
Cells Sequence Derived From: 094M , FH05 , FH15 , NV , RDP20 , WT47  
Known Ethnic Origin Of Source: Caucasoid
Publications
Hou L et al. Tissue Antigens 69:250-4 2007. abstract
Valiante NM et al. Immunity 7:739-51 1997. abstract
Artavanis-Tsakonas K et al. J Immunol 171:5396-405 2003. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 6 Laboratories: 3
Protein Sequence (348 aa)
MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGV
SKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHL
SREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGN
PRHLHILIGTSVVIILFILLFFLLHCWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQ
RPKTPPTDIIVYTELPNAESRSKVVSCP
Nucleotide Sequence Data (1047 bps)
ATGTCGCTCTTGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACATGAGGGAGTCCACAG
AAAACCTTCCCTCCTGGCCCACCCAGGTCGCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCA
TGTTTGAACACTTCCTTCTGCACAGAGAGGGGATGTTTAACGACACTTTGCGCCTCATTGGAGAACACCATGATGGGGTC
TCCAAGGCCAACTTCTCCATCAGTCGCATGACGCAAGACCTGGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTC
CCCCTATCAGGTGTCAGCTCCCAGTGACCCTCTGGACATCGTGATCATAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCCGGGCCCCACGGTTCTGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTA
TCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGGGACCAAGGTCAACGGAACATTCCAGGCCAACTTTCCTCT
GGGCCCTGCCACCCATGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGACTCTCCATACGAGTGGTCAAAGTCAAGTG
ACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCGAAACCGGTAAC
CCCCGACACCTGCACATTCTGATTGGGACCTCAGTGGTCATCATCCTCTTCATCCTCCTCTTCTTTCTCCTTCATTGCTG
GTGCTCCAACAAAAAAAATGCTGCGGTAATGGACCAAGAGTCTGCAGGAAACAGAACAGCGAATAGCGAGGACTCTGATG
AACAAGACCCTCAGGAGGTGACATACACACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAG
AGGCCCAAGACACCCCCAACAGATATCATCGTGTACACGGAACTTCCAAATGCTGAGTCCAGATCCAAAGTTGTCTCCTG
CCCATGA
Genomic Sequence Data (14748 bps)
GTTCGGGAGGTTGGATCTCAGACGTGTTTTGAGTTGGTCATAGTGAAGGACACTAGGTGTCAAATTCTAGCGAGAACAAT
TTCCAGGAAGCCGTGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCC
TCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTCGGTC
GCGGCTGCCTGTCTGCTCCGGCAGCACCATGTCGCTCTTGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAAGCAA
TAGAGGGAGGGAGCGCGGGGATGGAGATCTGGGCCCAGAGGTGGAGATATAGGCCTGGAGGTGGAGTTATGGGCCTGGAG
TGGAGATCTGGGCCTGGAGTGGATATATGGGCCTAGAGATGGAGTGATGGGCCTAGAAGTGGAGATCTGGGCCCAGAGGT
CGAGATATAGGCCTGGAGGTGGAGTGATGGGACTGTAGTGGAGATCTGGGCCTGGAGTGGAGATAGGAACCTGGAGGGGA
GATAGGAACCTGGAGGGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGTCATGGGCCTGGAGGTGGAGT
TACGGGCCTGCAGTAGAGATATGGGCCTGAAGTGGAGACATGGGCCTGGAGTGGAGATATGGGCCAGGAGTGGAGATATG
GGCCTAGAGGTCGATATCTGGGCCTGGAGTGGAGATATGGGCCAGGAGTGGAGATATGGGCCTAGAGGTCGATATCTGGG
CCTGGAGAGGAGATATGTGCCTAGGATGGAGATACGGGCCTGGGTGTGGAGATATGGGACTGGAGAGGATATATGGGCCT
GGAGTGGAGATATGGGACTGGAGAGGAGATATGGACCTGGAGTGGAGATAAGGGCCTGGATTGGAGATATGGGCCCAGGG
TGGAGATCTGAGCCTGGATTGGAGATATGGGCCTGGATTGGCGATATGGGCTTAGGGTGGAAATATCGGCCTGGAGTGGA
GATATGGGCCTGGAGTGGAGATATGGGCTTGAGGTGGGGATATGGACCTGGAGGCTGGGTCTCTGCACAGCCGACAGCCC
TGTTCTTGGGTGCAGGTAGGCACTGAGGGTGAGTTTACCTTCAGCCCAGGAAGGGCCTGGCTACCAAGACTCACAGCCCA
GTGGGGGCAGCAAGGGTGCCCTGGTTTGCCTGCAGATGGGTCATCCATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTG
CAGGGGGCCTGGCCACATGAGGGTGAGTCCTTCTCCAAACCTTCGGGTGTCATCTCCCCACATAAGAGGATTTTCCTGAA
ATGGGAGGGAAGTCCTGTCAGGGAGTCTCTCATAAACTAGGAAGAAGGGACCCTGGGGTGCTGGGCCCACATTTCTGACC
TTGCCTCCCTGGCCTTTCATTCCCTTGGCAGAGTCAAGTTCTGTGGGGACCAGGGTTAGACTACGGTGCTCAAAGCTGGG
GTGTGTGGTGGGGAAGTGGTAGGAACAGCAGATCCTCTGAGGACAAAGGTGTTACTCACACACTTCAGCGTTTCCATGAC
GGTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCAGAAGAGGTGGGAAAACCACAGCCATGGCCCTGACATTCCAATCC
TCTGATGGGGACTCAGTTGTTTATTTTCGTTCAGGCATCAGCTGATATTCCATTCTCAAAGGACATGCCCTCCACCCCAT
GTCTACCCTGTGTTGTTTTATGTGAGTAATCTTACAGTATTAAAATCTAGTAGGAGTCTCTTACTCAGCACTTGCTCAAA
GTTCTCAGCTGACACTTTTGTTGTAGGGAGACACCTTGTGTTTGCGGGATGGGTCCTTCCTTTAGCCCTGGGCACCAAGG
TGTGATAGCAGCCATAGAAACTTGGAAAGCGAGGAGAATCTTCAGAGCACAGGGAGGGAGGGGTGGCTCCACATCCTCCT
CTCTAAGGCGGTGCCTCCTTCTCCCCAAGGTGGTCAGGACAAGCCCTTGCTGTCTGCCTGGCCAAGCCCTGTGGTGCCTC
CAGGACATGTGATTCTTCAGTGTCATTCTTATCTTGGGTTTAACAACTTCAGTCTGTAAAAGGAAGATGGGGTGCCTGTC
CCTGAGCTCTACAACATAATATTCTGGAACAGCCTTTTCATGGGCCCTGTGACCCCAGCACACGCAGGGACCTATACATG
TCGGGGTTCACAACCACACTACCCCAGTGGGTGGTCGGCACCCAGCAACCCCCTGGAGATCACGGTCACAGGTCAGAGGG
CTCCTGTCTGGGATTCTCCTTGTCCCACCTCCTGAATCCCAGAGCTCCTGGTGGGCGTGTCCTTGCGGGTCCCATCATGC
AAGTCCTGACTGTATTTGGGGTAAAGGGGGATTGAATACAGGGAAATGGGTGCTGTGGTGGGAAGCACTGTGTTGTCCCC
AGTGATGACTACATTCTAATCCCTGGAGTCTGTGACTATTTATGATATAGGGGAAGGGACTGAAGGAGAAGATGGAGCTC
AGGTTGTTGATGAGTTGACCTTGAGATGGGGAGAAGGCCTGGACTGTCCTGATGGGCTCAGTGTAGTCACAGGGGTCCAC
ATGAAAGGAGGAGGAAGAGGGGAGTGGGGATTACAGCAGCATAATGGGAGTCTCCATCAGCTTTGAAGGTGGAGGAAGTC
CAGGAGCCATGAATGCAGGTGGCCTATAGAGGCTGGAAAAGTCAAGGAACTGATTCTCCTGAGTCTCCAGAGGGAACGAA
GCCCTGCAGGTACCTTGATTTTACCCACGACAAACAGGGTCCGATTTCTGTCTCCAGAATTGGAAGGGGTTAGTGTGCTC
TCTCCTGCTGCCATGCTTCTGATAATTTTCTACAGCAGCAACAGGAAACCAACACTGGAACCCAGGTCAAGGACAGGTTA
AGAAACAACACAAGGATAGCCAGGCATGGTGGCAGGTGCATGTAATCCTAGCGACTTGGGAGGCTGAGGGCAGGAGAATC
ACTTGAACCCAGGAGACAGAGGTTGCAGTAAGCCTAGACCACACCACTTCACTCCAGCCTGGGCAAAGGAGTGAGACTCT
GTCGCCAAAATTAATTAATTAATTAAAGAAACCAAACAAGGAGAAGGTTGGCTACACTGAGATCAGCAAGGCTCGGATGA
TGATGCCACCACCAGGCTCCATCCACATAGGGAGCGGTTGATACTCCTCCAACCAGCACCAGGAGCCAGGCTATGGAAGC
TGGCACTGGCATGGCAAGAGTGTCTCCCAGTCCCTACCAGGAACAGGGTGTGTGGCCACTGGTGCCTGCCTTACTGATCA
GTTCATACCTCCTGCCAAGGATTCCAATTCGTCCAAAAGAGATTGAACCAGGCTGCTAAGAGCCTGGATGTGCAGCCTAT
CCTGGTTCCTCTTCCACCCCCACACAGACAGCAGGAAAGACATTAGTTCGAAATAGATACAACAGCCCAAGAGATGAGGC
TGAGCCCAGCGGCAAGGGAATCAGAGGCTACTAGAGACAGAGGGACAGAGAAGAGTGAGGGAGACAGATGGAAGGACCTG
CACCAGGAGTTATGGGCACAGAAAAGAACATGAAGACACAGAGAGGAAGGAGAGAGATAAGACACCAGGAAGGGGAAGCC
TCACTCAATCCAGGTGCCATGGATGGGATGATAAAGAGAGACACCTTCTAAACTCACAACCTCTCTTCCTAGGAGTCCAC
AGAAAACCTTCCCTCCTGGCCCACCCAGGTCGCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGT
CATGTTTGAACACTTCCTTCTGCACAGAGAGGGGATGTTTAACGACACTTTGCGCCTCATTGGAGAACACCATGATGGGG
TCTCCAAGGCCAACTTCTCCATCAGTCGCATGACGCAAGACCTGGCAGGGACCTACAGATGCTACGGTTCTGTTACTCAC
TCCCCCTATCAGGTGTCAGCTCCCAGTGACCCTCTGGACATCGTGATCATAGGTGAGAGTGTCCAGACTTTCTTCTCATT
GTCATTGGGATGCAGAGTGAATGATCCAGGACTTGGAGGCCCAGGTGGCTGTAAGGAAGATGAGCTTGGTATTCTTATGG
AGAGAGACTGACTTGGTGAGGTCTGTGCCAACAGAGACAGAGAAACAGGAGACACAAGTAGAGACCAGGTGTCATAACAG
AGAACAGACACAGGGGCCATACCGGGAGTTTGAAAAGACAGAAAGAGTTAAAGGAGACACACAGACAGACATGTCCCAGA
GAGAGGTGTCCCTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAAG
TGTTCTCTACCAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCACCT
ACAGATGCCATGTTTATTCTGACACCTCTGCCTTCCATGTAATGGAGAGTAATCGTCCCAGGATATCATGGCCCCACAAC
ACCAACCCCTGTATGCTGTGTGAACTTGTAGTCTCCAGACTGGATTCTGAGGCTCATATTCCAAATAAGCCCACTTATGA
GAGGATCAGTGAGAGGCACAGAGAGAAATCAGGGACACCAAAAAGCAAAGACATAAACACACAGAGAATGAGCCAGAGGA
AGGAGATTGAGCGACTCACAGACACATAAAGAGAGAGAAAAGAGGGCAGAGAAGTGAGAATGATGGAAGGGAGCAGAGAA
AATCACTAAAGTTAGACTCCTGAGGGAGAGGCACAAGGACATTGAAAGATGGAGATGTGGGGATGAATTGCAGAGATTCC
AAAGAGAACTAGAGAGACCGAGAGGCAGAGCAAGACAGATGATAGATGGATAGATATAGATAGATGATAAATAGGTAGAT
GATAGATAATAGGTTATAGATACATAGATGATGATTGATTGATTCATTAATAGATGAGACATAGAGATGATGATGATGAA
GACACATAGATAGATAATACATAGAGATACAGAGGCAGACATAGAGAAATCATAGAGAGAGAGAGATGATACATAGATAT
AGATAATAGATGATTGATGGATAGATAGACAATTGATGGATAAATAGATGATATATAGATATAGATGACAGGTAGAGAAT
TTGTAGATAGGCACCGAATAGATAAATAGATAGATCGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACAGGACA
CAAAGTGAGAAACTCAGAATTAAAAAAAGTAACATCAAGTCAACCAATCCAAGGAGAGTCAGAGAGAATAAAACAATCCA
AAAAGAGAAAACATATCTAGAGGTGGGGAAGTGAGGTCAGAGACCTAGAGAGACAGAGAAGGTGGAAGGAGGAAATAGAC
ATGAAGAGCGATGGGGTAGAGGGTGAGAGAGAGAGAGAGAGAGCATTAGGTCATAGAACAGGGGAGTGAGTTCTCAGCTC
AGGTGAAGGGAGCTGTGACAAGGAAGATCCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTTC
TCTCTCAGCCCAGCCGGGCCCCACGGTTCTGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACA
TGTACCATCTATCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGGGACCAAGGTCAACGGAACATTCCAGGCC
AACTTTCCTCTGGGCCCTGCCACCCATGGAGGGACCTACAGATGCTTCGGCTCTTTCCGTGACTCTCCATACGAGTGGTC
AAAGTCAAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAGCCCATGGCTGTCCCATGTCCTATGATCCTAGAGCC
TTAGCTGAGGAGCTTCCTGCTGATGATGGAGAGAAGCATGGACAGATGCAGAGAGAAGACGCAGCCTCGGTGTGAGGGAG
GGATCAGGGCACAGGATGGCCGACAGGGCACCTCCAAACCCTCCTACATGGCCTGCATGGAGGCCCACGGCCAGGGCTCC
AGGCACCCAGGCAGATGGAGAAAGCGGTCAGGAGAGACCCAGAGGAGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGT
TCCCTCAGCCCCTCAACCTTACCCATTTCCCAGAAGCCCATCCTGGCCTCTCACCCACACAGAGATGTCATCACCAGCAA
CCCCTACACCCTTTACTTTTCTTTGAAGAAATATTTATTGAGGATAAATATACCTATATAGCTTACCACTTTTAACATTT
TTTTTTGAGGTGGAGTCTAGCTGTGTCCCCTATGCTGGAGTGCAGTGGCACAATCTCAGCTCACTGCAACCTCCACCTCC
TGGGTTCAAGCGATTCTCCTGCCTCAGCCACCTGAGTAGCTGGTGCTACAGGCACGCACCACCACGCCAGGCTACTTTTT
GTATTTTTAGTAGGGAGGTGGTTTCACCATGTTGGTCGAGCTGGTCTCGAACTCCTGACCAAGTGATCCACCCGCATCTG
CCTCCCAAAGTGCTGGGATTACAGGCATGGGCCACCGCGCCCAGCCACATTTACCATTTTTAAGTGTAAAGTCTAGTGGT
CATAAATACATTTATATACATATATATATATACATTTTTTTTACCCTCCACCCTTTTCTTCCTGTCCTCCAGTAGCCACC
ATTCTACTCTCTACCTTCATGAGATCCACCTTTTAGCTCCTGTATATGGGTGAGAAATGGGAATCTTTGTAATGACCTCC
AGTTCCATCCATGTGGCTGCAAATGACAGGATGTTATTCTTTCTATGGATGAGTAGTCTCCACTATGCGTATGTACTACA
TTCTCTCTATCCATTTACCCACTGATGGGCAGGTAGGTTGACTCCTCATCTTGGCTACTGTGAACAGTGCTGCACCAATC
ATACGAGTGCAGATATCACTTCGATATATTGATTTACTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGATACTA
TGAAAGTTCTCTTTTTTTCTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGCCCAAGCTGGAGTCAAAGTGGTGCG
ACCTTGGCTCATTGCAACCTACGCCTCCTGGGTTCAAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCTGGGATTACAGG
TGCACACCACCATCCCTGGCTACTTTTTGGTTTTTTTAGTATAGATGGGGTTTCCCCATGTTGGCTGGGCTGCTCTCAAA
CTCATGACCTCAACTGAGGTGCCCGCCTCAGTCTCCCAAAGTGCCGGGATTACAGGCATGATCCACCGCACCCAACCTCT
TTTTAGTTCTTTAAAGGACTTCCATACTTTTCTCCGTAATGGCTGTACTAATTTACACTCCTCCCAACAGGGTACCAGGG
TTCTCCTTTCTCTACCACCTTGCCAGCATTTCTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTTATTTCATTTTAT
TTTGAGATGGAGTTTTGCTCTTCTCACCCAGGCTGGAGTGCAGTGGCGCGATCTCGGCTCACCACAACCTCCACCTCCCA
GGTTCAAGCGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGAATTACAGGCACACGCCACCACGCCCGACTAATTTTTGT
ATTTTTAGTAGAGACAGCGTTTCTCTATGTGGGTCATACTGGTCTCAAACTCCCGACCTTATGAGATTCACCCACCTCAG
GCTCTCAAAGTTCTAGGATGACAAACGTGAGCCACCTCACCCGGCCTAAAAGCCATTTTAATGGGGTGAGATGAAAACTC
ACTTTGAATTTAATTTGCGTTTCTCTGATGATGAGTGATACTGAGCAGTTTTTCGTATGTGGGGAAATTTCATGTCTTTT
GCTCCTTTTTCAATTAAATCATTTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCTAGTTATTAATCCCATCTCAGAT
GCATAGTTTGCACATATTTGCTCCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCGGTGCAGAAGTTG
CTTAGTATGAGGTAATCCCAATGGTCTATTTTTGCTTCGATTACTTGTGTTTTCAAGGTTTAAAACAAAATGTCTTTCTT
CAGACAAGTGTCCTGGAGCATTTCCCCAATATTTTGTTCTACGTGTTTCATAGGTTCAGGCCTTAGACTCACATCTTTAA
TCCATTTTCATTTGATTTTTGTGTATGGTGACAGGTAGAGGTGCAGTTTCATTCCTCTGCATGTAGATGTCCAGGTTTCC
CTGCACTGTTTATTGAAAAGACTGTCCTTTCCTGATTGTGAGTTCTTGGCATCTTTGTCAAAGTCCATTGGATGGGCTGG
GCTTGGTGGCTAACACCTGCAATTTCAGCACTTTGGGAGCCCAAGGTGGGTGGATCACCTGAGGCCAGGAGTTCAAGATT
AGTCTGGCCGACGTGATGAAACATCATCTCCACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCACCTGTAATAC
CACTACTCAGGAGTTTGAGGCAAGAGAATGATTGAACCCAGGAGGCTGAGGTTGCAGTGAACCGAGATTGCACCTTTGCA
CTCCAGCCTGAGTGACAGAGCAAGACTCCATCTCAAAAGAAAAAATAAAAAACCATTGGATGTAAATGCATGGAATATAT
CTGTGTTATTCATTCTGCTCCGTTGTTCTATGTGCCTTTCTTTATGCCAATGTCATGCTATTTTGCTTACTACAGCTCTG
TAACATATTTTGAGATCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATACCTTGAAGTCTCAAGACAGTGGGTGTCACAT
AAAAAAATTATGGAAAAAAGGATCCCAGGACTCCCAGGGCCCAATATTAGATAACAGAGTGTTGGCCATGAACCATCCTC
AAAGATTTCCACTGAGTGGAGGACAGAAACCCTCATTTCCTCACCTCTCTCCTGTCTCATGTTCTAGGAAACCCTTCAAA
TAGTTGGCCTTCACCCACTGAACCAAGCTCCGAAACCGGTGAGTACAGAACCCTCTTATATCCGCTTTTGGAAACCTGGG
GAGGTGGAAACCTTGGATTCAGGCGTTGACTCAGCATCTCACAGCTCTGACATTGTACACCTGTCTTCCACCATCTCCGA
ACTCCAGATACTCCTACAGCGAAAGGGATCTGGGCCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTCATTTTATGGA
GCTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAATGTTTGTTCTGCCTG
CATTCCTAACTGGAGGATAAATTCCTGGAGACTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGCGAGGTGTTTTA
GAGAAGTTCCACTTGCCAAGGAATGAGCTCCTGTAGGTCATGAAGCAACCCTGGCTGACTCAGCAGAGCAAGAGCCTTGC
CGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTCAGGCTGTGCA
GTGCGGAACCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTTTTTAATTATC
TTACAGTGCTGTAGCTCAAAGTAGGAAGTGCATCTTACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCTTCCCTCTGA
GGATTCCAGGCACGAATCTGCTTCTCACTTGTCCCAGCTTCTAAAGGCTCCCAGTTCCTTGGCTCCTGGTCCCCTTCCTC
CTTCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGTGCCTTCTTCCTTACCACACTTCTTTCTCT
GAATGCTGCTCTCCCTTCTTCCTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCCTCATAA
TCTCCTGGAAATCATCCAGGATACCCTTGTTTTAAGTTCAGCTGATTAGTAACCATAATTCCATCTGCAATCTTCATTCC
TCCTTTCCATGTAAAATAACATATTCACAAGCTATGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGCATTCTCCTG
CCTTCCACAAACAGTGAACAAGATGCATTTGGCCTCTGCCCTTGGGACACTGATATTGCAGATGGTTAAATGGGAGGGCA
GAAAATGAATGCACAAGTGGATCTATAAATGAATGATCCATTGGGAAGCATCTGTGCGTGAAATCTATTTTTTGTTTGTT
CTTTTGTTTATTGAGACAGAGTCGCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCACTGCAACCTGC
GTCTCCTGGATTCAAGTGATTCTCCTGCCTCCGCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCGTGCCCGGCTA
ATTCTTTTTGTATATTTTTTGTAGAGAGGATGTTTCACCACGTTGGCCAAGCTTGTCTGAAACTCCCAACCTCAAGTGAT
CCGACCGTCTCAGCATGCCAAAGTAATGGGACTACAGGCGTGAGCCACTGTGCCCAGCCAGAATTCAAAATCAATAATAG
ATAATGCTGAGTGTATGATTTCAGGTGACAAAGAAGGTCTCACTATTCAGATATTTGTGACATTAATGAAAAACACGGAT
TGAACCCCTGAAAGATTGGCGGAAGGATTTTGCACACACAGCTGTCAGCCGTGAAGGCACAAAGGTGAAAACAATCTGAT
ATGGAAGGAAGAGGCTCTGCCTCAAATGCTGGGAATGATGTGGGGAGAATGACAAGATGACTGTAGAGAGACGGAGAGCA
CACTGGGTACACAGGAAACTAAGGAGCAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGAATTCACCTCGGGGTAAC
TAGGAATCCCTACATGATTAATATGACTGACATGAAAATAAGGGAGGCTCAGTTGCATAACTGGAATCTAGGAGACCGTG
GAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGATGGATATAAGATA
TGTTTGTGAGGTAGAATCATTGACTGGAAACGCTTACTGGGTTTGATTTTCCTACTTGTTTAATCCTCGCTTAATTAATT
TCTTTCTGAGATTTATTCATCCTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGGGGTGGTGGAAATG
AAGGGACCTATTATAGCATAATATACAAGTCTGTGAACGGTGGCTCACGCCTGTAACCCAGCACTGCAGGAGGCCAAGGC
GGGTGGATCACATGAAGTCAGCAGTTCGAGACCAGCCTGGCCAACATGGTGAAACCCTGTCTCTAGGAAAAACACAAAAA
TTAGCCGAGCATGGTGGTGCATCCCTGTAATCCCAGCTCCTACTCTGGAGGATGAAGCAGGAGAATGACTTCAACCCAGG
AGGTGGAGGTTGCAGTGAGTGGAGGTTGCATCACTGCACTCCAGCCTGGGTGGCACAAGGAGACTCCGTCTCAAAAAATA
AAAATAAGAAATGCATAAATATAAATATAATATAACACACGCAAATGACAAAGGGACCTGAATTCCAATCATGATTTTTC
TATTTCTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATGAGCCTAAAACCTCTTCCCTATTTGGCTTT
CTGTGAGCATGAGATCACATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCACAGATCCTGGAATAGAGAAAGTGCTCT
GGTCATCACAAAAAAAACTTGCCCACTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCACCTGTGGAGATTCAGAT
AGACCATGGGGAGGTAAACATTAACACTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATCAGCGACAGCACTAGCTC
CTGCTCCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTTTTGAAGCAATAGATGGCCGAGGGGGTGGTCCTTCCCCCA
GCCTCTCGGGTAGAACAGCAGCCTAATATGTGTCTCCCGAGATCACAAAGAGCAGCAGGTTTCACACGGGCTTCAACACT
ATTTCCTGGCCGTTTGACATAAGAGAATTCTATTTCGCTTTTTTTATCTTGATTTCACTTTTGTTTTCTTTCCTTGGAGA
ATGCAAGTTGTTTGATTCAAGAATGCTGTGGATGTAGAAACCCTAAAGCACATTCGCTGTGAATCAATCCCAGTCCAGTC
TTCCCAGAGAAGACTCTAAACACCTCCTGGACTGCACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTCCAGGGA
GACAGAACACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAACCTATAT
TTCAATGTGACCCAGTCCCTCAAGGCTCAGAAAAGCTCCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAGCTGCGG
GAAGCCAGAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCT
CCTCCAGGAAGAACAGGAAGACAGCCCAGGCTGTTCTGAGACGTTCCTCCTGATCTCAGGAAGTTGCTGTCTTAGGCCAT
TTTTGTTGCTCTAAAGGAACACTTGAGCCTCGGTAACTTCTAAAGAAAAGAGATTGGTTTGTCTCACCGTTCTGCAGGCT
GTACTGGAAGCATGGCACCAGCATCTATTTCTCGTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGTC
TGTCTGTGCAGAGACCACAGAGATCACACGGCAAGAGAGGGAGCAAGGGGGAGGGGGAGTGATGGAGCTTCCAAGCTCTT
TTTAACAACCAGCTCTCCGGGAACTAATAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGATGTGTTCAT
GATGGATCCACCTCCATGACCCAAACACCTCTCAAGAGGCCCAACCTCCCACAGTGGGGGTGAAATTTCAATGTGAGGTT
TGAAGGGGTCAAACATCTCAACTAAAGTAGTCGTATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAACTGAAAAA
GCAGGAGAAAGCTGGGTCTCCTGCTATCTGGGTGCTTGTCCTAAAGAGGTGTTTTATGTGGTTACCTGTCAATCAAGAAA
TGCGAGACAATTCATAAAGAGGAACTGCTAAGATTAGCTTCTTATTGGTGTCTCATCTTCTTCCAGGTAACCCCCGACAC
CTGCACATTCTGATTGGGACCTCAGTGGTCATCATCCTCTTCATCCTCCTCTTCTTTCTCCTTCATTGCTGGTGCTCCAA
CAAAAAAAGTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCACTCAGGTGTG
TGTTCCTCACAAACAGGATGGTCCCTGGCCCAAGGCAGCAGCCACAGAGGCAGGACTTTCTAGAGAGGGCACCAGACTCC
CTGTCCCTGCCTTCAACTCACAGACCGTTGCCTGATTCTGAACTGTATCCTCATGTCCACTGCAGCCACTCACATCCAGG
AGAAGGTTCCATGACAGGCAGAAAGTGGGAGACAGAATCAATGGGATGGGAACTCAGAGCTATTCATGGGATGGGTCCTT
GAGCTCAGAGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGCCACCTATGGTCTCCCCCTGTATGTT
GGTATCTGCTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTGTTTTGTTGACTTCCGTCTTCTACAGATGCTGCGGT
AATGGACCAAGAGTCTGCAGGAAACAGAACAGCGAATAGCGAGGTAGGTACTCCTCGGCCCGGGCTCGTGGCTACTGTTA
TTCCCAAAGAGTCCTGGAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGACTCTGATGAACAAGACC
CTCAGGAGGTGACATACACACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAAG
ACACCCCCAACAGATATCATCGTGTACACGGAACTTCCAAATGCTGAGTCCAGATCCAAAGTTGTCTCCTGCCCATGAGC
ACCACAGTCAGGCCTTGAGGGCGTCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATGTACCA
GCAGCTGGAATCTGAAGGCATGAGTCTGCATCTTAGGGCATCGCTCTTCCTCACACCACAAATCTGAATGTGCCTCTCAC
TTGCTTACAAATGTCTAAGGTCCCCACTGCCTGCTGGAGAAAAAACACACTCCTTTGCTTAGCCCACAGTTCTCCATTTC
ACTTGACCCCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTACTTGAGGCTGCAATCACACTGAGGAACTCA
CAATTCCAAACATACAAGAGGCTCCCTCTTAACGCAGCACTTAGACACGTGTTGTTCCACCTTCCCTCATGCTGTTCCAC
CTCCCCTCAGACTAGCTTTCAGTCTTCTGTCAGCAGTAAAACTTATATATTTTTTAAAATAACTTCAATGTAGTTTTCCA
TCCTTCAAATAAACATGTCTGCCCCCAT

IPD-KIR