Allele Report for 2DL1*00303


2DL1*00303
Previous Designations & Local Names: MJ/HT
IPD Acc No: KIR00005
Assigned: 28-JUN-2003 Sequence Last Modified: 24-JAN-2005
Source Entries: AY366239 , GQ406045 , GU182342  
Cells Sequence Derived From: FH08 , GM17132 , HT-NK , MJ  
Known Ethnic Origin Of Source: Black
Publications
Artavanis-Tsakonas K et al. J Immunol 171:5396-405 2003. abstract
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 4 Laboratories: 3
Protein Sequence (348 aa)
MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGV
SKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHL
SREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITRPSQ
RPKTPPTDIIVYTELPNAESRSKVVSCP
Nucleotide Sequence Data (1047 bps)
ATGTCGCTCTTGGTCGTCAGCATGGCGTGTGTTGGGTTCTTCTTGCTGCAGGGGGCCTGGCCACATGAGGGAGTCCACAG
AAAACCTTCCCTCCTGGCCCACCCAGGTCGCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCA
TGTTTGAACACTTCCTTCTGCACAGAGAGGGGATGTTTAACGACACTTTGCGCCTCATTGGAGAACACCATGATGGGGTC
TCCAAGGCCAACTTCTCCATCAGTCGCATGACGCAAGACCTGGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTC
CCCCTATCAGGTGTCAGCTCCCAGTGACCCTCTGGACATCGTGATCATAGGTCTATATGAGAAACCTTCTCTCTCAGCCC
AGCTGGGCCCCACGGTTCTGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACATGTACCATCTA
TCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGGGCCCAAGGTCAACGGAACATTCCAGGCTGACTTTCCTCT
GGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCATGACTCTCCATACGAGTGGTCAAAGTCAAGTG
ACCCACTGCTTGTTTCTGTCACAGGAAACCCTTCAAATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTAAC
CCCCGACACCTGCACATTCTGATTGGGACCTCAGTGGTCATCATCCTCTTCATCCTCCTCTTCTTTCTCCTTCATCGCTG
GTGCTCCAACAAGAAAAATGCTGCGGTAATGGACCAAGAGTCTGCAGGAAACAGAACAGCGAATAGCGAGGACTCTGATG
AACAAGACCCTCAGGAGGTGACATACACACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAG
AGGCCCAAGACACCCCCAACAGATATCATCGTGTACACGGAACTTCCAAATGCTGAGTCCAGATCCAAAGTTGTCTCCTG
CCCATGA
Genomic Sequence Data (14740 bps)
GTTCGGGAGGTTGGATCTCAGACGTGTTTTGAGTTGGTCATAGTGAAGGACACTAGGTGTCAAATTCTAGCGAGAACAAT
TTCCAGGAAGCCGTGTTCCGCTCTTGAGCGAGCACCCACTGGGCCTCATGCAAGGTAGAAAGAGCCTGCGTACGTCACCC
TCCCATGATGTGGTCAACATGTAAACTGCATGGGCAGGGCGCCAAATAACATCCTGTGCGCTGCTGAGCTGAGCTCGGTC
GCGGCTGCCTGTCTGCTCCGGCAGCACCATGTCGCTCTTGGTCGTCAGCATGGCGTGTGTTGGTGAGTCCTGGAAAGCAA
TAGAGGGAGGGAGTGAGGGGATGGAGATCTGGGCCCAGAGGTGGAGATATAGGCCTGGAGGTGGAGTTATGGGCCTGGAG
TGGAGATCTGGGCCTGGAGTGGATATATGGGCCTAGAGATGGAGTGATGGGCCTAGAAGTGGAGATCTGGGCCCAGAGGT
CGAGATATAGGCCTGGAGGTGGAGTGATGGGACTGTAGTGGAGATCTGGGCCTGGAGTGGAGATAGGAACCTGGAGGGGA
GATAGGAACCTGGAGGGGAGATATGGGCCTGGAGGTGGAGATATGGGCCTGGAGTGGAGTCATGGGCCTGGAGGTGGAGT
TATGGGCCTGCAGTAGAGATATGGGCCTGAAGTGGAGACATGGGCCTGGAGTGGAGATATGGGCCAGGAGTGGAGATATG
GGCCTAGAGGTCGATATCTGGGCCTGGAGTGGAGATATGGGCCAGGAGTGGAGATATGGGCCTAGAGGTCGATATCTGGG
CCTGGAGAGGAGATATGTGCCTAGGATGGAGATACGGGCCTGGGTGTGGAGATATGGGACTGGAGAGGATATATGGGCCT
GGAGTGGAGATATGGGACTGGAGAGGAGATATGGACCTGGAGTGGAGATAAGGGCCTGGATTGGAGATATGGGCCCAGGG
TGGAGATCTGAGCCTGGATTGGAGATATGGGCCTGGATTGGCGATATGGGCTTAGGGTGGAAATATCGGCCTGGAGTGGA
GATATGGGCCTGGAGTGGAGATATGGGCTTGAGGTGGGGATATGGACCTGGAGGCTGGGTCTCTGCACAGCCGACAGCCC
TGTTCTTGGGTGCAGGTAGGCACTGAGGGTGAGTTTACCTTCAGCCCAGGAAGGGCCTGGCTACCAAGACTCACAGCCCA
GTGGGGGCAGCAAGGGTGCCCTGGTTTGCCTGCAGATGGGTCATCCATCATGATCTTTCTTTCCAGGGTTCTTCTTGCTG
CAGGGGGCCTGGCCACATGAGGGTGAGTCCTTCTCCAAACCTTCGGGTGTCATCTCCCCACATAAGAGGATTTTCCTGAA
ATGGGAGGGAAGTCCTGTCAGGGAGTCTCTCATAAACTAGGAAGAAGGGACCCTGGGGTGCTGGGCCCACATTTCTGACC
TTGCCTCCCTGGCCTTTCATTCCCTTGGCAGAGTCAAGTTCTGTGGGGACCAGGGTTAGACTACGGTGCTCAAAGCTGGG
GTGTGTGGTGGGGAAGTGGTAGGAACAGCAGATCCTCTGAGGACAAAGGTGTTACTCACACACTTCAGCGTTTCCATGAC
GGTAGGGGCTGCAGTGTGGCTGCTGTCATTCTACCAGAAGAGGTGGGAAAACCACAGCCATGGCCCTGACATTCCAATCC
TCTGATGGGGACTCAGTTGTTTATTTTCGTTCAGGCATCGGCTGATATTCCATTCTCAAAGGACATGCCCTCCACCCCAT
GTCTACCCTGTGTTGTTTTATGTGAGTAATCTTACAGTATTAAAATCTAGTAGGAGTCTCTTACTCAGCACTTGCTCAAA
GTTCTCAGCTGACACTTTTGTTGTAGGGAGACACCTTGTGTTTGCGGGATGGGTCCTTCCTTTAGCCCTGGGCACCAAGG
TGTGATAGCAGCCATAGAAACTTGGAAAGCGAGGAGAATCTTCAGAGCACAGGGAGGGAGGGGCGGCTCCACATCCTCCT
CTCTAAGGCGGTGCCTCCTTCTCCCCACGGTGGTCAGGACAAGCCCTTGCTGTCTGCCTGGCCAAGCCCTGTGGTGCCTC
CAGGACATGTGATTCTTCAGTGTCATTCTTATCTTGGGTTTAACAACTTCAGTCTGTAAAAGGAAGATGGGGTGCCTGTC
CCTGAGCTCTACAACATAATATTCTGGAACAGCCTTTTCATGGGCCCTGTGACCCCAGCACACGCAGGGACCTATACATG
TCGGGGTTCACAACCACACTACCCCAGTGGGTGGTCGGCACCCAGCAACCCCCTGGAGATCACGGTCACAGGTCAGAGGG
CTCCTGTCTGGGATTCTCCTTGTCCCACCTCCTGAATCCCAGAGCTCCTGGTGGGCGTGTCCTTGCGGGTCCCATCATGC
AAGTCCTGACTGTATTTGGGGTAAAGGGGGATTGAATACAGGGAAATGGGTGCTGTGGTGGGAAGAATAATTGTCCCCAG
TGATGACTACATTCTAATCCCTGGAGTCTGTGACTATTTATGATATAGGGGAAGGGACTGAAGGAGAAGATGGAGCTCAG
GTTGTTGATGAGTTGACCTTGAGATGGGGAGACAGCCTGGACTGTCCTGATGGGCTCAGTGTAGTCACAGGGGTCCACAT
GAAAGGAGGAGGAAGAGGGGAGTGGGGATTACAGCAGCATAATGGGAGTCTCCATCAGCTTTGAAGGTGGAGGAAGTCCA
GGAGCCATGAATGCAGGTGGCCTATAGAGGCTGGAAAAGTCAAGGAACTGATTCTCCTGAGTCTCCAGAGGGAACGAAGC
CCTGCAGGTGCCTTGATTTTACCCACGACAAACAGGGTCCGATTTCTGTCTCCAGAATTGGAAGGGGTTAGTGTGCTCTC
TCCTGGTGCCATGCTTCTGATAATTTTCTACAGCAGCAACAGGAAACCAACACTGGAACCCAGGTCAAGGACAAGTTAAG
AAACAACACAAGGATAGCCAGGCATGGTGGCAGGTGCATGTAATCCTAGCGACTTGGGAGGCTGAGGGCAGGAGAATCAC
TTGAACCCAGGAGACAGAGGTTGCAGTGAGCCTAGACCACACCACTTCACTCCAGCCTGGGCAAAGGAGTGAGACTCTGT
CGCCAAAATTAATTAATTAATTAAAGAAACCAAACAAGGAGAAGGTTGGCTACACTGAGATCAGCAAGGCTCGGATGATG
ATGCCACCACCAGGCTCCATCCACATAGGGAGCGGTTGATACTCCTCCAACCAGCACCAGGAGCCAGCCTATGGAAGCTG
GCACTGGCATGGCAAGAGTGGCTCCCAGTCCCTACCAGGAACAGGGTGTGTGGCCACTGGTGCCTGCCTTACTGATCAGT
TCATACCTCCTGCCAAGGATTCCAATTCGTCCAAAAGAGATTGAACCAGGCTGCTAAGAGCCTGGATGTGCAGCCTATCC
TGGTTCCTCTTCCACCCCCACATAGACAGCAGGAAAGACATTAGTTCGAAATAGATACAACAGCCCAAGAGATGAGGCTG
AGCCCAGCGGCAAGGGAATCAGAGGCTACTAGAGACAGAGGGACAGAGAAGAGTGAGGGAGACAGATGGAAGGACCTGCA
CCAGGAGTTATGGGCACAGAAAAGAACATGAAGACACAGAGAGGAAGGAGAGAGATAAGACACCAGGAAGGGGAAGCCTG
ACTCAATCCAGGTGCCATGGATGGGATGATAAAGAGAGACACCTTCTAAACTCACAACCTCTCTTCCTAGGAGTCCACAG
AAAACCTTCCCTCCTGGCCCACCCAGGTCGCCTGGTGAAATCAGAAGAGACAGTCATCCTGCAATGTTGGTCAGATGTCA
TGTTTGAACACTTCCTTCTGCACAGAGAGGGGATGTTTAACGACACTTTGCGCCTCATTGGAGAACACCATGATGGGGTC
TCCAAGGCCAACTTCTCCATCAGTCGCATGACGCAAGACCTGGCAGGGACCTACAGATGCTACGGTTCTGTTACTCACTC
CCCCTATCAGGTGTCAGCTCCCAGTGACCCTCTGGACATCGTGATCATAGGTGAGAGTGTCCAGACTTTCTTCTCATTGT
CATTGGGATGCAGAGTGAATGATCCAGGAATTGGAGACCCAGGTGGCTGTAAGGAAGATGAGCTTGGTATTCTTATGGAG
AGAGACTGACTTGGTGAGGTCTGTGCCAACAGAGACAGAGAAACAGGAGACACAAGTAGAGACCAGGTGTCATAACAGAG
AACAGACACAGGGGCCATACCGGGAGTTAGAAAAGACAGAAAGAGTTAAAGGAGACACACAGACAGACATGTCCCAGAGA
GAGGTGTCCCTCCATGCTGACTTTGCTCAGAGACCTGGCACAGGTTAGAAGTTTCATTTCTGTTTTACCTCCACAAAGTG
TTCTCTACCAGGAGAACCCAAGGACACCCATATTTCTGACCTGAGTTGGGCCCTGTGGCCTCAGGCCTTGTGGCACCTAC
AGATGCCATGTTTATTCTGACACCTCTGCCTTCCATGTAATGGAGAGTAATCGTCCCAGGATATCATGGCCCCACAACAC
CAACCCCTGTATGCTGTGTGAACTTGTAGTCTCCAGACTGGATTCTGAGGCTCATATTCCAAATAAGCCCACTTATGAGA
GGATCAGTGAGAGGCACAGAGAGAAATCAGGGACACCAAAAAGCAAAGACATAAACACACAGAGAATGAGCCAGAGGAAG
GAGATTGAGAGACTCACAGACACATAAAGAGAGAGAAAAGAGGGCAGAGAAGTGAGAATGATGGAAGGGAGCAGAGAAAA
GCACTAAAATTAGACTCCTGAGGGAGAGGCACAAGGACATTGAAAGATGGAGATGTGGGGATGAATTGCAGAGATTCCAA
AGAGAACTAGAGAGACCGAGAGGCAGAGCAAGACAGATGATAGATGGATAGATATAGATAGATGATAAATAGGTAGATGA
TAGATAATAGGTTATAGATACATAGATGATGATTGATTGATTCATTAATAGATGAGACATAGAGATGATGATGATGAAGA
CAGATAGATAGATAATACATAGAGATACAGAGGCAGACATAGAGAAATCATAGAGAGAGAGAGATGATACATAGATATAG
ATAATAGATGATTGATGGATAGATAGACAATTGATGGATAAATAGATGATATATAGATATAGATGACAGGTAGAGAATTT
GTAGATAGGCACCGAATAGATAAATAGATAGATCGATAGATAATAGATAGAAATATGCAGAAAGTTATGAACAGGACACA
AAGTGAGAAACTCAGAATTAAAAAAAGTAACATCAAGTCAACCAATCCAAGGAGAGTCAGAGAGAATAAAACAATCCAAA
AAGAGAAAACATATCTAGAGGTGGGGAAGTGAGGTCAGAGACCTAGAGAGACAGAGAAGGTGGAAGGAGGAAATAGACAT
GAAGAGCGATGGGGTAGAGGGTGAGAGAGAGAGAGAGAGAGAGCATTAGGTCATAGAACAGGGGAGTGAGTTCTCAGCTC
AGGTGAAGGGAGCTGTGACAAAGAAGATCCTCCCTGAGGAAACTGCCTCTTCTCCTTCCAGGTCTATATGAGAAACCTTC
TCTCTCAGCCCAGCTGGGCCCCACGGTTCTGGCAGGAGAGAATGTGACCTTGTCCTGCAGCTCCCGGAGCTCCTATGACA
TGTACCATCTATCCAGGGAAGGGGAGGCCCATGAACGTAGGCTCCCTGCAGGGCCCAAGGTCAACGGAACATTCCAGGCT
GACTTTCCTCTGGGCCCTGCCACCCACGGAGGGACCTACAGATGCTTCGGCTCTTTCCATGACTCTCCATACGAGTGGTC
AAAGTCAAGTGACCCACTGCTTGTTTCTGTCACAGGTGAGGAAAGCCCATGGCTGTCCCATGTCCTATGATCCTAGAGCC
TTAGCTGAGGAGCTTCCTGCTGAGGATGGAGAGAAGCATGGACAGATGCAGAGAGAAGACGCAGCCTCGGTGTGAGGGAG
GGATCAGGGCACAGGATGGCAGACAGGGCACCTCCAAACCCTCCTACATGGCCTGCATGGAGGCCCACGGCCAGGGCTCC
AGGCACCCAGGCAGATGGAGAAAGCGGTCAGGAGAGACCCAGAGGAGGGAGACTGGGCTCAGTTTGGGGAGATCAGAGGT
TCCCTCAGCCCCTCAACCTTACCCATTTCCCAGAAGCCCATCCTGGCCTCTCACCCACACAGAGATGTCATCACCAGCAA
CCCCTACACCCTTTACTTTTCTTTGAAGAAATATTTATTGAGGATAAATATACCTATATAGCTTACCACTTTTAACATTT
TTTTTTGAGGTGGAGTCTAGCTCTGTCCCCTATGATGGAGTGCAGTGGCACAATCTCAGCTCACTGCAACCTCCGCCTCC
TGGGTTCAAGCGATTCTCCTGCCTCAGCCACCTGAGTAGCTAGTGCTACAGGCACGCACCACCACGCCAGGCTACTTTTT
GTATTTTTAGTAGAGAGGTGGTTTCACCATGTTGGTCGAGCTGGTCTCGAACTCCTGACCACGTGATCCACCCGCATCAG
CCTCCCAAAGTGCTGGGATTACAGGCATGGGCCACCAGGCCCAGCCACATTTACCATTTTTAAGTGTAAAGTCTAGTGGT
CATAAATACATTTTTATATATATATATATATACATTTTTTTTACCCTCCACCCTTTTCTTCCTGTCCTCCAGTAGCCACC
ATTCTACTCTCTACCTTCATGAGATCCACCTTTTAGCTCCTGTATATGGGTGAGAAATGGGAATCTTTTTAATGACCTCC
AGTTCCATCCATGTGGCTGCAAATGACAGGATGTTATTCTTTCTATGGATGAGTAGTCTCCACTGTGCGTATGTACTACA
TTCTCTCTATCCATTCACCCACTGATGGGCAGGTAGGTTGACTCCTCATCTTGGCTACTGTGAACAGTGCTGCACCAATC
ATACGAGTGCAGATATCACTTCGATATGTTGATTTACTTTCCTTTGGATATAAACCCAGTAGTGAAATTGCTGGATACTA
TGAAAGTTCTCTTTTTTTTTTTTTTTTCTTTTTTGAGAAAGAGTTTCCCTCCTTAGCCCAAGCTGGAGTCAAAGTGGTGC
AACCTTGGCTCATTGCAACCTCCGCCTCCTGGGTTCAAATGATTTTCCTGCCTCAGCCTCCCTAGTAGCTGGGATTACAG
GTGCACACCACCATGCCTGGCTACTTTTTGGTTTTTTTAGTATAGATGCGGTTTCCCCATGTTGGCTGGGCTGCTCTCAA
ACTCATGACCTCAACTGAGGTGCCCGCCTCAGTCTCCCAAAGTGCCGGGATTACAGGCATGATCCACCTCACCCAACCTC
TTTTTAGTTCTTTAAAGGACTTCCATACTTTTCTCCGTAATGGCTGTACTAATTTACACTCCTACCAACAGGGTACCAGG
GTTCTCCTTTCTCTACCACCTTGCCAGCATTTCTTTTGCCTGTCTTGCAGCTAAAAGCCATTTTATTTTATTTCATTTTA
TTTTGAGATGGAGTTTTGCTCTTCTCACCCAGGCTGGAGTGCAGTGGCGCTATCTCGGCTCACCACAACCTCCACCTCCC
AGGTTCAAGCGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGAATTACAGGCACACGCCACCACGCCCTACTAATTTTTG
TATTTTTAGTAGAGACAGCGTTTCTCTATGTGGGTCAGACTGGTCTCAAACTCCCAACCTTATGAGATTCACCCACCTCA
GGTTCTCAAAGTTCTAGGATGACACAAGTGAGCCACCTCACCCGGCCTAAAAGCCATTTTAATGGGGTGAGATGAAAACT
CACTTTGATTTTAATTTGCGTTTCTCTGATGATGAGTGATACTGAGCACTTTTTCGTATGTGGGGAAATTTCATGTCTTT
TGCTCCTTTTTCAATTAAATCATTTGTTTTATTGAGTTGTTTGAGCTTCTTATATTTCTAGTTATTAATCCCATCTCAGA
TGCATAGTTTGCACATATTTGCTCCCAATCTGTGGGTTGTCTCTTCACTTTGTTGGTTTATTTTTAGCAGTGCTGAAGTT
GCTTAGTTTGAGGTAATCCCAATGGTCTGTTTTTGCTTCGATTACTTGTGTTTTGAAGGTTTAAAACAAAATGTCTTCCT
TCAGACAAACGTCCTGGAGCATTTCCCCAATATTTTGTTCTACGTGTTTCATAGGTTCAGGCCTTAGACTCACATCTTTA
ATCCATTTTCATTTGATTTTTGTGTATGGTGACAGGTAGAGTTGCAGTTTCATTCCTCTGCATGTAGATGTCCAGGTTTC
CCTGCACTGTTTATTGAAAAGACTGTCCTTTCCTGATTGTGAGTTCTTGGCATCTTTGTCAAAGTCCATTGGATGGGCTG
GGCTTGGTGGCTAACACCTGCAATTTCAGCACTTTGGGAGCCCGAGGTGGGTGGATCACCTGAGGCCAGGAGTTCAAGAT
TAGTCTGGCCAACGTGATGAAACATCGTCTCCACTAAAAATATAAAAATTAGCTGAGCATGGTGGTCAGCACCTGTAATA
CCACTACTCAGGAATTTGAGGCAAGAGAATGATTGAACCCAGGAGGCTGAGGTTGCAGTGAACCGAGATTGCACCTCTGC
ACTCCAGCCTGAGTGACAGAGCAAGACTCCATCTCAAAAGAAAAAATAAAAAACCATTGGATGTAAATGCATGGAATATA
TCTGTGTTATTCATTCTGCTCCGTTGTTCTATGTGCCTTTCTTTATGCCAATGTCATGCTATTTTGCTTACTACAGCTCT
GTAACATATTTTGAGATCAGGTAGTGTGATGCTCCTGTTTTCTCTTTATATCTTGAAGTCTCAAGACAGTGGGTGTCATA
TAAAAAAATTATGGAAAAAAGGATCCCAGGACTCCCAGGGCCCAATATTAGATAAGAGAGTGTTGGCCATGAACCATCCT
CAAAGATTTCCACTGAGTGGAGGACAGACACCCTCATTTCCTCACCTCTCTCCTGTCTCATGTTCTAGGAAACCCTTCAA
ATAGTTGGCCTTCACCCACTGAACCAAGCTCCAAAACCGGTGAGTACAGAACCCTCTTATATCCGCTTTTGGAACCCTGG
GGAGGTGGGAACCTTGGATTCAGGCGTTGACTCAGCATCTCACAGCTCTGACATTGTACACTTGTCTTCCACCATCTCCG
AACTCCAGATACTCCTACAGCGAAAGGGATCTGGGCCCAACACAGGGCTCAGTGAAATCTCTTCATCTCTCATTTTATGG
AGCTGAGACCTCCTACAAGCTAGAAGAATGATTGCCAATCTGACATCCTTCTCAGGAAAAATGCAATGTTTGTTCTACCT
GCATTCCTAACTGGAGGATAAATTCCTGGAGACTTGAGAGAGGGAAGGGAAGGGAACATCTGATGAGGGCAAGGTGTTTT
AGAGAAGTTCCACTTGCCAAGGAATGAGCTCCTGTAGGTCATGAAGCAACCCTGGCTGACTCCGCAGAGAAAGAGCCTTG
CCGTAACAGAGAACAGAGCTCATGCACGCACACTTCGACTCACTGACTCATTCAGCCACGGCCCCATGCTCAGGCTGTGC
AGTGTGGAACCTTTTCCTATTGTTGCCATAACAAATTTCCACAAGATTCGTGGGTGAAAACAAAACGGTTTTTTAATTAT
CTTACAGTGCTGTAGCTCAAAGTAGGAAGTGCATCTTACTGGGCTAAAATCAAGGTGACAGCAAGGCTGCCTTCCCTCTG
AGGATTCCAGGCACGAATCTGCTTCTCACTTGTCCCAGCTTCTAAAGGCTCCCAGTTCCTTGGCTCCTGGTCCCCTTCCT
CCTTCCTCAAAGCCCACAAAGACTGGTCACATCTCACATGGCATCACTCAGTGCCTTCTTCCTTACCACACCTCTTTCTC
TGAGTGCTGCTCTCCCTTCTTCCTCATCTTTTGAAAACTTGGGGATTCTATTGGGTTCACCAAGATGAAAATCCCTCATA
ATCTCCTGGAAATCATCCAGGATACCCTTGTTTTAAGTTCAGCTGATTAGCAACCATAATTCCATCTGCAATCTTCATTC
CTCCTTTCCATGTAAAATAACATATTCACAAGCTGTGGAGGCTAGGACAGGGACATTTTGGGGTGGGACAGCATTCTCCT
GCCTTCCACAAACAGTGAACAAGATGCATTTGGCCTCTGCCCTTGGGACACTGATATTGCAGATGGTTAAATGGGAGGGC
AGAAAATGAACGCACAAGTGGATCTATAAATGAATGGTCCATTGGGAAGCATCTGTGCATGAAATCTATTTTTTGTTTGT
TCTTTTGTTTATTGAGACAGAGTCGCCCTCTGTCTTCCAGGCTACAGTGCAGTGTCACGATCTTGGCTCACTGCAACCTG
CGTCTCCTGGATTCAAGTGATTCTCCTGCCTCCGCCTCTCGAGTAGCTGGGATTACAGGCAACTGCCACCGTGCCCGGCT
AATTCTTTTTGTATATTTTTTGTAGAGAGGATGTTTCACCACGTTGGCCAAGCTTGTCTGAAACTCCCAACCTCAAGTGA
TCCGACCGTCTCAGCATGCCAAAGTAATGGGACTACAGGCGTGAGCCACTGTGCCCAGCCAGAATTCAAAATCAATAATA
GATAATGCTGAGTGTATGATTTCAGGTGACAAAGAAGGTCTCACTATTCAGATATTTGTGACATTAATGAAAAACACGGA
ATGAACCCCTGAAAGATTGGCGGAAGGATTTTGCACACACAGCTGTCAGCCATGAAGGCACAAAGGTGAAAACAATCTGA
TGTGGAAGGAAGAGGCTCTGACTCAAATGCTGGGAATGAGGTGGGGAGAATGACAAGACGACTGTAGAGAGACGGAGAGC
ACACTGGGTACACAGGAAACTAAGGAGGAACAAGGAGTGTGTGTTTGACACTCACAGCCATTGGATTCACCTCGGGGTAA
CCAGGAATCCCTACATGATTAATATGACTGACATGAAAATAAGGGAGGCCCAGGTGCATAACTGGAATCTAGGAGACCGT
GGAAAAGGCAATTGCCGCCCCACTGGTGAAATGTGGTGCTGATTTAGACACTAAATGAATGAAGTAGATGGATATAAGAT
ATGTTTGTGAGGTAGAATCATTGACTGGAAAGGCTTACTGGGTTTGATTTTCCTACTTGTTTAATCCTCGCTTAATTAAT
TTCTTTCTGAGATTTATTCATCCTACACATAAATCAATACCTGGCAAAGGAGTGACAGATATATGAGTGGTGGTGGAAAT
GAAGAGACTTATTATAGCATAATATACAAGTCTGTGAACAGTGGCTCACGCCTGTAACCTAGCACTGCAGGAGGCCAAGG
TGGGTGGATTCCATGAAGTCAGGAGTTCCAGACCAGCCTGGCCAACGTGGTGAAACCCTATCTCTACTAAAAATACAAAA
ATTAGCCGAGCACGATGGTGCATCCCTGTAATCCCAGCTCCTATTCTGGAGGATGAAGCAGGAGAATGACTTCAACCCAG
TAGGTGGAGGTTGCAGTGAGTGGAGATTGCATCACTGCACTCCAGCCTGGGGGACACAAGGAGACTCTATCTCAAAAAAT
AAAAATAAGAAATACATAAATATAATAAAACACACACGAATGACAAAGGCACCTGAATTCCAATCATGATTTTTCTATTT
CTCTATAATTACTTCTTTGATCCTTTATCTTATCCATTAGGCAATGAGCCTAAAACCTCTTCCCTATTTGGCTTTCTGTG
AGCATGAGATCATATAGAAAATGTGAAAGCCCGCTGAATCCTCCAGCACAGATCCTGGAATAGAGAAAGTGCTCTGGTCA
TCACAAAAAAAACTTGCCCACTCACCCAAATCCCCCACCTCACCCCTACTTCCAATCACCTGTGGAGATTCAGATAGACC
ATGGGGAGGTAAACATTAACACTCCTTGGAGTGAGTCCAGATCTTGGAATCAGAGATCAGCGACAGCACTAGCTCCTGCT
CCCCTTTCCTACTAATTCACAGGAGGACAGGTGGTTTTGAAGCAATAGATGGCCGAGGGGGTGGTCCTTCCCCCAGCCTC
TCGGGTAGAACAGCAGCCTAATATGTGTCTCCCGAGATCACAAAGAGCAGCAGGTTTCACACGGGCTTCAACACTATTTC
CTGGCCGTTTGACATAAGAGAATTCTATTTCGCTTTTTTTATCTTGATTTCACTTTTGTTTTCTTTCCTTGGAGAATGCA
AGTTGTTTGATTCAAGAATGCTGTGGATGTAGAAACCCTAAAGCACATTCGCTGTGAATCAATCCCAGTCCAGTCTTCCC
AGAGAAGACTCTAAACACCTCCTGGACTGCACCTGGGCCTATGCCAATTCCTATCACTCACCGTCACTCCAGGGAGACAG
AACACACAGAGAATACGTTACATAGGCAGGTTCATTACTAACAGATAAGCAGCGAGTGACAACAGAAACCTATATTTCAA
TGTGACCCAGTCCCTCAAGGCTCAGAAAAGCTCCTCGGGACATATGGAGTCACCCCATTTGCAGTGTAGCTGCGGGAAGC
CAGAAAGCAGCCCAGCCTGGGTTTTGTACCCTGGAGCCACAGGAAGCACTCAGCTAAAGCACTGCATGACGTCCTCCAGG
AAGAACAGGAAGACAGCCCAGGGTGTTCTGAGACGTTCCTCCTGATCTCAGGAAGTTGCTGTCTTAGGCCATTTTTGTTG
CTCTAAAGGAACACTTGAGCCTCGGTAACTTCTAAAGAAAAGAGATTGGTTTGCCTCACCGTTCTGCAGGCTGTACTGGA
AGCATGGCACCAGCATCTATTTCTCGTGACGGCCTCAGGCTGCTCCCACTCTGGCAGAAGGGAAGGAGGGTCTGTCTGTG
CAGAGACCACAGAGATCACACGGCAAGAGAGGGAGCAAGGGGGAGGGGGAGCGATGGAGCTTCCAAGCTCTTTTTAACAA
CCAGCTCTCCGGGAACTAATAGAGGGGGAACTTGCTAACCCCGTCTCCTTGGGACAGCATTGATGTGTTCATGATGGATC
CACCTCCATGACCCAAACACCTCTCAAGAGGCCCAACCTCCCACAGTGGGGGTGAAATTTCAATGTGAGGTTTGAAGGGG
TCAAACATCTCAACTAAAGTAGTCGTATCCTCAGCACGTTCTATGGTTACTATGAGAGCTATAACTGAAAAAGCAGGAGA
AAGCTGGGTCTCCTGCCATCTGGGTGCTTGTCCTAAAGAGGTGTTTTATGTGGTTACCTGTCAATCAAGAAATGCGAGAC
AATTCATAAAGAGGAACTGCTAAGATTAGCTTCTTATTGGTGTCTCATCTTCTTCCAGGTAACCCCCGACACCTGCACAT
TCTGATTGGGACCTCAGTGGTCATCATCCTCTTCATCCTCCTCTTCTTTCTCCTTCATCGCTGGTGCTCCAACAAGAAAA
GTAAGTCTCACGAAGCAGAGGCCAGAGAGCTCAGGGCCATGTGGGGAAGCAGGATGGGAGCACTCAGGTGTGTGTTCCTC
ACAAACAGGATGGTCCCTGGCCCAAGGCAGCAGCCACAGAGGCAGGACTTTCTAGAGAGGGCACCAGACTCCCTGTCCCT
GCCTTCAACTCACAGACCGTTGCCTGATTCTGAACTGTATCCTCATGTCCCCTGCAGCCACTCACATCCAGGAGAAGGTT
CCATGACAGGCAGAAAGTGGGAGACAGAATCAATGGGATGGGAACTCAGAGCTATTCATGGGATGGGTCCTTGAGCTCAG
AGAGATAGAATGTCTGAGTCTGCTGTTGGCAACTGAGGGACCTCAGCCACCTATGGTCTCCCCCTGTATGTTGGTATCTG
CTTATGAAATGAGGACCCAGAAGTGCCCTCCGAGCTGTTTTGTTGACTTCCGTCTTCTACAGATGCTGCGGTAATGGACC
AAGAGTCTGCAGGAAACAGAACAGCGAATAGCGAGGTAGGTACTCCTCGGCCCGGGCTCGTGGCTACTGTTATTCCCAAA
GAGTCCTGGAAAATGTGAGCACCCTCCCTCACTCAGCATTTCCCTCTCTCCAGGACTCTGATGAACAAGACCCTCAGGAG
GTGACATACACACAGTTGAATCACTGCGTTTTCACACAGAGAAAAATCACTCGCCCTTCTCAGAGGCCCAAGACACCCCC
AACAGATATCATCGTGTACACGGAACTTCCAAATGCTGAGTCCAGATCCAAAGTTGTCTCCTGCCCATGAGCACCACAGT
CAGGCCTTGAGGGCGTCTTCTAGGGAGACAACAGCCCTGTCTCAAAACCGGGTTGCCAGCTCCCATGTACCAGCAGCTGG
AATCTGAAGGCATGAGTCTGCATCTTAGGGCATCGATCTTCCTCACACCACAAATCTGAATGTGCCTCTCACTTGCTTAC
AAATGTCTAAGGTCCCCACTGCCTGCTGGAGAAAAAACACACTCCTTTGCTTAGCCCACAGTTCTCCATTTCACTTGACC
CCTGCCCACCTCTCCAACCTAACTGGCTTACTTCCTAGTCTACTTGAGGCTGCAATCACACTGAGGAACTCACAATTCCA
AACATACAAGAGGCTCCCTCTTAACGCAGCACTTAGACACGTGTTGTTCCACCTTCCCTCATGCTGTTCCACCTCCCCTC
AGACTAGCTTTCAGTCTTCTGTCAGCAGTAAAACTTATATATTTTTTAAAATAACTTCAATGTAGTTTTCCATCCTTCAA
ATAAACATGTCTGCCCCCAT

IPD-KIR