Allele Report for TAP2*01:01:02

TAP2*01:01:02 View HGVS Report
Pre-2010 Nomenclature: Local Names: TAP2
IMGT/HLA Acc No: HLA06625 OMIM Entry: *170261
Assigned: 2011-02-28 Sequence Last Modified: 2011-04-08
Source Entries: AL671681  
Cells Sequence Derived From:  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 0 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (686 aa)
MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLCLATPLTVSLR
ALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLV
LAVLGETLIPHYSGRVIDILGGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLFSSLLRQDLGF
FQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVGLYGFMLSISPRLTLLSLLHMPFTIAAEKVYNTRHQEVLRE
IQDAVARAGQVVREAVGGLQTVRSFGAEEHEVCRYKEALEQCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQ
DGELTQGSLLSFMIYQESVGSYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNR
PDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSV
RNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQ
CEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL
Nucleotide Sequence Data (2112 bps)
ATGCGGCTCCCTGACCTGAGACCCTGGACCTCCCTGCTGCTGGTGGACGCGGCTTTACTGTGGCTGCTTCAGGGCCCTCT
GGGGACTTTGCTTCCTCAAGGGCTGCCAGGACTATGGCTGGAGGGGACCCTGCGGCTGGGAGGGCTGTGGGGGCTGCTAA
AGCTAAGAGGGCTGCTGGGATTTGTGGGGACACTGCTGCTCCCGCTCTGTCTGGCCACCCCCCTGACTGTCTCCCTGAGA
GCCCTGGTCGCGGGGGCCTCACGTGCTCCCCCAGCCAGAGTCGCTTCAGCCCCTTGGAGCTGGCTGCTGGTGGGGTACGG
GGCTGCGGGGCTCAGCTGGTCACTGTGGGCTGTTCTGAGCCCTCCTGGAGCCCAGGAGAAGGAGCAGGACCAGGTGAACA
ACAAAGTCTTGATGTGGAGGCTGCTGAAGCTCTCCAGGCCGGACCTGCCTCTCCTCGTTGCCGCCTTCTTCTTCCTTGTC
CTTGCTGTTTTGGGTGAGACATTAATCCCTCACTATTCTGGTCGTGTGATTGACATCCTGGGAGGTGATTTTGACCCCCA
TGCCTTTGCCAGTGCCATCTTCTTCATGTGCCTCTTCTCCTTTGGCAGCTCACTGTCTGCAGGCTGCCGAGGAGGCTGCT
TCACCTACACCATGTCTCGAATCAACTTGCGGATCCGGGAGCAGCTTTTCTCCTCCCTGCTGCGCCAGGACCTCGGTTTC
TTCCAGGAGACTAAGACAGGGGAGCTGAACTCACGGCTGAGCTCGGATACCACCCTGATGAGTAACTGGCTTCCTTTAAA
TGCCAATGTGCTCTTGCGAAGCCTGGTGAAAGTGGTGGGGCTGTATGGCTTCATGCTCAGCATATCGCCTCGACTCACCC
TCCTTTCTCTGCTGCACATGCCCTTCACAATAGCAGCGGAGAAGGTGTACAACACCCGCCATCAGGAAGTGCTTCGGGAG
ATCCAGGATGCAGTGGCCAGGGCGGGGCAGGTGGTGCGGGAAGCCGTTGGAGGGCTGCAGACCGTTCGCAGTTTTGGGGC
CGAGGAGCATGAAGTCTGTCGCTATAAAGAGGCCCTTGAACAATGTCGGCAGCTGTATTGGCGGAGAGACCTGGAACGCG
CCTTGTACCTGCTCGTAAGGAGGGTGCTGCACTTGGGGGTGCAGATGCTGATGCTGAGCTGTGGGCTGCAGCAGATGCAG
GATGGGGAGCTCACCCAGGGCAGCCTGCTTTCCTTTATGATCTACCAGGAGAGCGTGGGGAGCTATGTGCAGACCCTGGT
ATACATATATGGGGATATGCTCAGCAATGTGGGAGCTGCAGAGAAGGTTTTCTCCTACATGGACCGACAGCCAAATCTGC
CTTCACCTGGCACGCTTGCCCCCACCACTCTGCAGGGGGTTGTGAAATTCCAAGACGTCTCCTTTGCATATCCCAATCGC
CCTGACAGGCCTGTGCTCAAGGGGCTGACGTTTACCCTACGTCCTGGTGAGGTGACGGCGCTGGTGGGACCCAATGGGTC
TGGGAAGAGCACAGTGGCTGCCCTGCTGCAGAATCTGTACCAGCCCACAGGGGGACAGGTGCTGCTGGATGAAAAGCCCA
TCTCACAGTATGAACACTGCTACCTGCACAGCCAGGTGGTTTCAGTTGGGCAGGAGCCTGTGCTGTTCTCCGGTTCTGTG
AGGAACAACATTGCTTATGGGCTGCAGAGCTGCGAAGATGATAAGGTGATGGCGGCTGCCCAGGCTGCCCACGCAGATGA
CTTCATCCAGGAAATGGAGCATGGAATATACACAGATGTAGGGGAGAAGGGAAGCCAGCTGGCTGCGGGACAGAAACAAC
GTCTGGCCATTGCCCGGGCCCTTGTACGAGACCCGCGGGTCCTCATCCTGGATGAGGCTACTAGTGCCCTAGATGTGCAG
TGCGAGCAGGCCCTGCAGGACTGGAATTCCCGTGGGGATCGCACAGTGCTGGTGATTGCTCACAGGCTGCAGACAGTTCA
GCGCGCCCACCAGATCCTGGTGCTCCAGGAGGGCAAGCTGCAGAAGCTTGCCCAGCTCTAGGAGGGACAGGACCTCTATT
CCCGCCTGGTGCAGCAGCGGCTGATGGACTGA
Genomic Sequence Data (10606 bps)
ACAAAGCAAGGACAACAGATAAAGTTGCCCTTGAGACAACTGTATTTTACTTAATGATAAAGAAACATTTTTGCAGTTTT
ATATCCCAGAGTAACCGCCACTAAAGGCGAGTGAGACTCATTGCAGGCCTGTACAGTGCGAACCAGAGTTCGGGCTCCAG
TTCCGCTGTCTGCGGGTCTCGCGCGCCCCCTCCCGGCGGCCCAGCCCAGAATGAAGGCCTTGGCTGGGGAAGCGAAAGCG
AAAGCTGCCCGAGCCCTGACGCCCGCCCTGGCCGAGCGTAGCTGGCGGACCAGAGCCGGTAGCGAGGTTGGGAGAGACGG
AGCGGACCTCAGCGCTGAAGCAGAAGTCCCCGGAGCTGCGGTCTCCCCGCCGCGGCTGGTGAGTTGGTGCGGAGGGGAAC
CTGGAGCGCCAACAGGGACGCAGCCCAAGTGACTACCCACTCCACGCTCCTGCTTCCCAGTCCCTCTGCACCCGGCGATA
GGAGGGAGCGGAGCCCGGACCACTTAGCTCGCCGCGGCAGGCGGGGGTGGGGGTGGGGGTCCGGGGATTTTTTTTTTTTT
TTTTTAAGCACGAGGCTCCTGATGGTCATGCTTCCAGCTCCCCAGAAGGCCGAAAGCTGTCTGTCGTAGGAGGGGTGTAC
GGATGAGCACCGGTTACTCAGGAGAGCTCTCAGGGTTGAATAGGATAAAATGAGAAGCCGATGGACGGGTTAGGCGGAGC
CGGGCGGGTAGGAGGGCAGGGACAAGGATTGGGACTCCACCCCCATGATTTCTCATCTCGTATCCGTTGACAGAGCCATG
CGGCTCCCTGACCTGAGACCCTGGACCTCCCTGCTGCTGGTGGACGCGGCTTTACTGTGGCTGCTTCAGGGCCCTCTGGG
GACTTTGCTTCCTCAAGGGCTGCCAGGACTATGGCTGGAGGGGACCCTGCGGCTGGGAGGGCTGTGGGGGCTGCTAAAGC
TAAGAGGGCTGCTGGGATTTGTGGGGACACTGCTGCTCCCGCTCTGTCTGGCCACCCCCCTGACTGTCTCCCTGAGAGCC
CTGGTCGCGGGGGCCTCACGTGCTCCCCCAGCCAGAGTCGCTTCAGCCCCTTGGAGCTGGCTGCTGGTGGGGTACGGGGC
TGCGGGGCTCAGCTGGTCACTGTGGGCTGTTCTGAGCCCTCCTGGAGCCCAGGAGAAGGAGCAGGACCAGGTGAACAACA
AAGTCTTGATGTGGAGGCTGCTGAAGCTCTCCAGGCCGGACCTGCCTCTCCTCGTTGCCGCCTTCTTCTTCCTTGTCCTT
GCTGTTTTGGGTGAGTCAGGAGAGGACGTTGTGAGTTGGAGGTGGTAAAAGGGCCTGGGCACCAGCACATTCTTGTGTTA
TTTTTCATGCCTCTTTCAGGTGAGACATTAATCCCTCACTATTCTGGTCGTGTGATTGACATCCTGGGAGGTGATTTTGA
CCCCCATGCCTTTGCCAGTGCCATCTTCTTCATGTGCCTCTTCTCCTTTGGCAGGTAGGTGGTGGGCAGCTGGGTCCATT
TGCTAGCCCCAAATCTTTATAGGGGTCTTCACTTCCCTAACTCCATTTCTAGGCCCTTTCAGGCGCAAAACACAAAAATA
CTTAAACTAAAATATGGTGAATGTAGTCACCATTCTGTTTCATCTATCCATTCATTTCTTCCTTCGTTCATATTCATCCA
ATATCTTCAAAGTTTATCTGATCTTATTATAGGAACAAGTTATGAGTGAAGGTAGTACAAAAGGAATTTAAGTCTCAGAT
GGAATGTCTCTCAGTTGTCTCTCAACATTCCTAGGTCCATGAAATTCCATTTCTTTCTGCCTCCTACCTCCTACCCCTAA
GTCTGTCTCCAAAGTATCTCTCCAGGGTCACTCCCTCAGGATGGGTATGCTTCTCCCTTTCACTCTTCTTTCCCAGCTCA
TCTTGCCAGTCCCTGAAGATCTTACTCTGAGGCTTATCACCTTTCTTTCCAGAATCATTACTCTTTTCCCTTCACTTGCT
TTCCTTTCTCTTTCTAGACATACTCAAACAAACAAACTGTTTGATAAGGCTGGGACTGGGATGAGGTGAGCGAGGCACCT
GGGGTGCAAAGTTTAAGGAGGTGTGCACTCACCTTACCCAAATCCCAGCCGGCCTGATTGTCTCTATTTTTATGGTCATA
CTTAATTTAGAGTACCCTCGAAAACCATTTCATTGTGCCTTCATTCCATCCTGGCTGCTTTCTGCTGAAACTACAGTCGT
GCACTGCATAACGATGTTTAGGTCAATGATGGGCCACATATAAGATGGTGGACCCACAAGATTATAATACCATATTTTTA
CTGTACCTTTTCTATGTTTAGATACACAAATACTTACTTCTGTGTTACAGTCGCCCACAGTGTTAGGTGCAGTCATATGT
TGTACAGATTTGTAGCCTAGGAGCAATAGGCTAAACTACATGGCCTAGGTGTGCAGTAGGCTATGACATCTAGGTTTGTG
TAAGTACACTCTATGATGTTCATACAACAATGAAACCATCTAATGACACATTTCTCAGAACACATCCCTGTCATTAAAGT
ACAAACCCTCATTATATCATGTCTGACTCTCCCAAACGCCTCTTCAATATGGTAACTAAATTTGTATTAGAAACATATAT
TTTGTAAAATACATGCTTTTATGCTTTATATTTTTTCCTCTAAGTGTTACTGTAGCATGTAGTTGGTCTAAGAGGGATTT
TCCAACTCGAAGGATGAAAGATGGGAATCACATGACTCTGGGGCTCCAGAGAATTGTGGGGGCAGGGAATTTATTATTGC
AGTTCCCATGATGAAGTATCTATGATGACAGAGAAGGGCTTTGGGTATGGGGCAGGAAGGAGACCAAGGCGGAGGAGACG
CACAGAGGGACAAGCCTGAGGGACGCTGGGACAGAAGCAAGCACTGGGATACTTGTTTTCACAATATCTTTTCCCTTCTA
TTGTAGTCTTCTATTGTGTCTAGTACAGAGTGCACTCCATAAATACTTGTAAATTTGTACATGTTATGATTTTGTTCTCA
CATCTAGCTCACCATGTCTCCTCTTTCTTCTTCCTCTGTGTATTCCTTACCTCTTCTCTCTCTGTGTGTCTGTCTCTCAT
TTCTTTCTCTTTTGCCCCTCCTGGCATGCTTTCCCCTGACTTTGCGCTTCTCTGCACTCCTGGCTTGCTCCTCTGTTTCA
CCCGCTGGCTTGCTCCTTCTCTGCATCTCCCTCCCCTCTTATTCTCCTACCCCACAGCTCACTGTCTGCAGGCTGCCGAG
GAGGCTGCTTCACCTACACCATGTCTCGAATCAACTTGCGGATCCGGGAGCAGCTTTTCTCCTCCCTGCTGCGCCAGGAC
CTCGGTTTCTTCCAGGAGACTAAGACAGGTGGGCCTGGAGTCCAGGTCTGAGATTCCCATGGACATCCCTTGCCCCTCAG
TGACCTTCCACCCACAGCCTCTCCTCCTGCCTTCACCCGTATGCCAGGACCTGGGGATGCTTTTCTCTTGTTTGGGACAG
GGTGGAGAAGCAGCCTCCACTGTCCCTCTGCAAGTGAAGGAGGATGTTCAGAGGAGGGGGCTGTGTCAGAGGGAACGGTC
AGGAGGGAGTTTCTGGGGGCCCTGCAGTACACATGGTTTCCTTTTTCCTCACCTGCTCTGTCCTTCTTAGGGGAGCTGAA
CTCACGGCTGAGCTCGGATACCACCCTGATGAGTAACTGGCTTCCTTTAAATGCCAATGTGCTCTTGCGAAGCCTGGTGA
AAGTGGTGGGGCTGTATGGCTTCATGCTCAGCATATCGCCTCGACTCACCCTCCTTTCTCTGCTGCACATGCCCTTCACA
ATAGCAGCGGAGAAGGTGTACAACACCCGCCATCAGGTGAGCGTGCATGTAAGGGAACCCCAAAGGGAGAATAAAACTGA
CAGGTGAGGAGGCTTCCACATTTGTGGCTAGAGGATCCCCTAGAGAGAGATGTTCTCTTCTCAGCCGTTAGGGGAGAAGA
TATATTGTAGTATATACTACATTTTGTTTGTCCAGCCATCCAACAATGGATATTTGACTTCAGAAGATTCATGATTCTCC
AGAACTGTAAACAAAAATGTAAAGTGTATGTGAAGGTATGGGGGAGGGAATAGGAAGGGGAGATGATAGGCGATGATAAC
TTTTCATTAGCTTCTCAAAGGAGTCTGTACATCCCCCGCCCCCACTGCGAAGATTAAAAATGGTTTCTTAGAGGCTTTTA
GGCAGGGAGATTTTCCCTTTAAAATCAGCAGAAGAAGTCTGGATGCAGCATAGGGAAAGGAGGCGTCATCAGGAAGTCCT
AAGTCTGAATGTCAGCTCCACCTTCTCTTTTTCTCTTATATTGTGGTAAAACATACATAACATAAAATTTACCATTTCAA
CCATTTGAAGTGTACAGTTCAGTGACATTTAGGAAACCCACATTGTTATTGGGTAACCATCATCACCATCCATCTCCAGA
ACTTTTTTCATCTTCCTAAAATGAAACTCTGTACCCACTAAATAGTAACTGCCTACTACCCCCAACCCCTGGCCGCTGGC
AACCTCCATTGTACCTTCTGTCTCCATGAATTGTGATGACTCCAGGTGCGGTACGTAAGTGGAACCATACAGTATTTGTC
TTTTTGTGACTGGCATATTTTACTTAGCGTAATGTCTTCAGGCCTCATCCATATTGTAGCATGTGTTAGAATTTCCTCCC
TTTTAAGGCTGAATAATATTCTGTTGTGTGCATATATCACATTTTGATTATCCATTCATCTGTCAATGGACATTTGCGTT
GTTTCCACCTTTTGGCTGTTGTGAATTATGCTGCTGTGGACATGAGTGTACACCTGTTTGAAACCCTGCTTTTGGTTCTT
TTGGGTATATACTTAGAAGTGGAGCTGCTGGATCATATGGCAATTCTATTTAACAATTTTTGAGGAACCATGTATTAGTC
CATTTTTACGCTGCTGATAAAGACATACCCAAGATTGGGCAATTTACAAAAGAAAGAGGTTTATTGGACTTACAGTTCCA
TGTGGCTGGGAAGACCTCACAATCATGGCGGAAGGTGAAAGACACATTTCACATGGCAGCAGACAAGAGAAAAGACAGCT
TGTGCAGGGGAATTCCCCTTTTTAAAACCATTATATCTCGTGAGACTTATTCAATATCACAAGAACAGCATGGGAAAGAC
TTGCCCTCATGATTCAATTACCTCCTACCCAGTCCCTCCCACAACACATGGGAATTCAAGATCAGATATGGGTAGGGACA
CAGCCAGATCGTATCAAACCACCATACAGTTTTCCATAGCGGCAGCACCATTTTAAATTCCCACCAGCAGTGCATAAGGT
TTCCAATTTCTCCACATCCTCATCAACACCACTTTCTGTTGTCTTTTTTTTAATAGCCATTCTAATGGTGATTAGGTGAT
TAGGATTATCTCATTGTGGTTTTGATTTGCATTTCCCTAATGATTAGTAAATATTGAGCATCTTTTCGTGTGATTTTGGC
CACTTATGTTTCTTTCTTGAAAGAATGTCTGCAAGTTCTTTGCCCATTTTCTGATTTTTTTTTAAGTTGTGGGAGTTCAC
TATATGTTTTGCCTATTAATTTCCTATCAGATATATGATTCACAAATATTTTCTTGTATTTCATGGTTGCTTTTTCACTC
TGTTGCTAGAGTTCTTTGATGCACAAACGTTTTAAATTCTGATGAAGTCTGATTTATCTATTTTTTGTTGCCTGTGCGTT
TGGTGTTATATCCAAGAAATCACTGCCAAATCTAGTGGCATGAGGCTTTTCTTCTACATTTTCCTAGGAGTTTTATAGTG
TTAGCTCTTATGTTTAGGCCTCTGATCCATTTGGAATTACATCTCCACCTTTCTTAACTATCTGTGGCTCCTTGGGAAAA
CTACCCTTCTTTCCTGATTCAGACACTGGGGATGGGAAAATTACCTCAAATGAAGGTTAAAAAAATTGCATGTATCTCCT
ATACTACCTAACACTGAGAGCTCAATAATATTTTGTTCCCTTGCTCCTTCACTCTTATTCCTTCTGGAAAGAAGAGTAAG
GAAGAGGGAGAGAAACAGTTTGGTATTTTTAGGTAGACTAGGGAGCATCTCACTGGCTGGAGTAAGATGTGGGGGCCTGC
TGTCTTTGCACATCAGCCCTGGTGTTTGCTGGCCCTCTTTTCCAGGAAGTGCTTCGGGAGATCCAGGATGCAGTGGCCAG
GGCGGGGCAGGTGGTGCGGGAAGCCGTTGGAGGGCTGCAGACCGTTCGCAGTTTTGGGGCCGAGGAGCATGAAGTCTGTC
GCTATAAAGAGGCCCTTGAACAATGTCGGCAGCTGTATTGGCGGAGAGACCTGGAACGCGCCTTGTACCTGCTCGTAAGG
AGGGTAAGATACCAGAGTGGTTGTGAAAGGAGCCCAGGAAAGGGGGAGGGCAAGGGAAGAGGAAACTACAGCTGGTTCTA
GAGGCCTTTGCAGCTCAGTCTCATAGAGGCAGAGAGGGGGAAAGAATGGGAAGATTCCCAGCCTCATCTCTTTCTTCTCC
TCTTCCAGGTGCTGCACTTGGGGGTGCAGATGCTGATGCTGAGCTGTGGGCTGCAGCAGATGCAGGATGGGGAGCTCACC
CAGGGCAGCCTGCTTTCCTTTATGATCTACCAGGAGAGCGTGGGGAGCTATGTGCAGGTGAGCGAGAAGCCAAGCCTGCT
CTCCTTTTTTCCCTCTCTTTTTCTTTGTGGACTCCTGGGCCTTGGGCTTTATTTGTTCTTTTTAACAATACAATACAAAA
CCAAAACCCGCAAGTAATTTTGCTATGGAGAATTTTAAACATATGCCAAAAATGAGACAAAATAATATTACAAACTCACA
TGTATACATCCTGTGCTTTAACAATGATCAACTCATGCCCAATCTTGTTGGATCTGTATCCCCAGCCACTTCCCCCCACC
CATATTATTCTGAAGCAAATCCAAGATATTGTATACTTTCATCTGTAAATATTTCAGTATGTTTCTTAAAAATACAAACA
TCTTTAAAAGTGTATAACAACAAAGCCATTATCACACCAAAAAATTAACAGTAGTTCTTAAAATTTATCAAATAGTCAAT
TGTCAAATTTCCACTTGTGGTATCCATGTAGTATATGTGTATGAGTGTGTTTATTATACTTTGCTTAAATCAGGATCCAG
AAATGGTCCACATATTGTGACTGGTTGATACATCTTTTAAGTCTGTCTGTCTATCTATCTATCCATCCATCTATCCATCC
ATCCACCCATCAATCCATGTATCTGTCTAAAAGTTTCCCTTGCACAGTTTATTTGTTGAAGAAATAGGTTGTTTGTCCTG
TGGAGTTTCTTAGGGTCTGGATTTTGTTGACTGAATCCCTGTGGTATTATATGCTCTTCTGCCTCTGTACTTCCTGTCTA
TTGATAGATAAACCTAGAAGCTTGTGAGATTGAGGGGTTTTTTTTGGTCTTTTTCCAGCAACAGTACTTTTTAGGTGGTG
ATGCATTCTTCCTCCAAGAGGCACACAATGTCTGGTTCTCTATTTGTGGCAACATCAGCCACTGATGAGCAGTACCTACA
TCCATGACAGAATTAGGGCTGCAAAAGGGAGATACTCTATCATTCTTCATGTATTAGCTGAAGTAGTCTATGAAGGGAGA
CTTCCCCTCATCTACCATTTCATTACCCGGTGGTACAGTTTGATGAGGAAAGGCAGAGTGAGCATTTAGATCTCTTCCTA
CATTTACCAGTTCTCAAAAACAGCTACTTCATCCAGGGCTTTATTTAAACATTTTCCTAGACACTTGATAAACATCTTTT
TTGTGTAGAGAACTGCGCTGGGCACTCTGACGGCTACAAAGGTGAGTTGGGCACAGTGCCTGCATTTAAGGAGCTCCCCG
TCTAATCAAGCAAGACAGAACTGGGCACAAGTAATAGGAAGCAGTAACTGAAAAGATCTGGGGCTAGAGGCAATGCTGTA
TGGTAGGAGAATGGACTGTATATCCTTTATATTGCAAATTGGAACACTGGGGTATTGGTGCCACTTTTAAATTCCATCCA
AATTGTACATTTAAAGGTGGAGAATCTCTTTTGAGTATGGAGGAGGAGCAGTGCAGTTGTGAGTGGAGTGTGTGAGGAGT
TGGGAGGGTGGTTTCTGGTAGAAGTGTGTTTAATTAGCCGGCTCTCCCATTCCTGTTTTCCAGACCCTGGTATACATATA
TGGGGATATGCTCAGCAATGTGGGAGCTGCAGAGAAGGTTTTCTCCTACATGGACCGACAGCCAAATCTGCCTTCACCTG
GCACGCTTGCCCCCACCACTCTGCAGGGGGTTGTGAAATTCCAAGACGTCTCCTTTGCATATCCCAATCGCCCTGACAGG
CCTGTGCTCAAGGTGCCTGAAAGAGGGAGGAAACCTGGACCCTTGCTCTCTGCTGCTAATGCATAATTGGACATCACAGC
CTATAGTTCATTTGCCTCTGAGAACCTGGTCTTGCCTCTGCTAAGAAGAGAAATGGAGGGATTTTGAGGGAGAAGGGGCA
GGCCCTTAACTCTTTTTCTGGTTTTCTAGGGGCTGACGTTTACCCTACGTCCTGGTGAGGTGACGGCGCTGGTGGGACCC
AATGGGTCTGGGAAGAGCACAGTGGCTGCCCTGCTGCAGAATCTGTACCAGCCCACAGGGGGACAGGTGCTGCTGGATGA
AAAGCCCATCTCACAGTATGAACACTGCTACCTGCACAGCCAGGTGGGTGAGGAGGGAGAAGACAGGGGACAGGAGAGGG
GAGCATGTACAGAGAGAGGATGGGAGATCCACGGGAAGGCGCACCAGGTGTTCATTCTGAGGGAGGTAGGTGGGGAGGAC
AAAAGGGCCCCTGCCTTGGGGGTTTACACATAGTCCTCTGCCCCTGTCCCCGCTGCACAGGTGGTTTCAGTTGGGCAGGA
GCCTGTGCTGTTCTCCGGTTCTGTGAGGAACAACATTGCTTATGGGCTGCAGAGCTGCGAAGATGATAAGGTGATGGCGG
CTGCCCAGGCTGCCCACGCAGATGACTTCATCCAGGAAATGGAGCATGGAATATACACAGGTATCTTCTACAAATTGTAA
GCCTGCTCCTTCAGTAAAAAAGAGAAAATCAGACTTACTCTTAGTGGTGAAGGTCGTGTCCCTGTAACTTGATGTTTGCT
GTTCCTCTGCCCTTTCCTCCATTCCTACGTCTCCTTCCCCACACACTGAATTCTTCAGCCTCCCTCTTGCTCAAGAGTCT
TTGTTTGCAGAGAGCAATGCAGCAGTGGTGCTCCCTCCATGGGCAGCCCCGTCAGGTCCCCACCCCATGGCCCTCCTCCC
ACTGGGCCCTCCCCGCACTGGGCCCTCCCACCTCCCGAGGTCCTACTGGAAGTACCTGCTGTGCACTTGTCCCTCCTTGT
GTGTTGTCTGTGTCACTTGTATCTGAGGAAGGGAATTTCTCTGATTTCCTCAGATGTAGGGGAGAAGGGAAGCCAGCTGG
CTGCGGGACAGAAACAACGTCTGGCCATTGCCCGGGCCCTTGTACGAGACCCGCGGGTCCTCATCCTGGATGAGGCTACT
AGTGCCCTAGATGTGCAGTGCGAGCAGGCCGTGAGTACCGTGAGAGGGCAGGGGACAGTGGGGCCTGGGAGGGGCATGCT
GGGAGGATCAGACTGTGCAGAATTGGGCAGAGGGAGGACGAAGGACCTACTAGTGGAAACAGTCTGTGCCTTCTTGGGGT
TGGGGAATGGAATCCGGTGGTGTGAGGGCAGCCCCAGTTCCCTCCTGGGCTTCCATTCCTCCAGCTGTGGCAGTACAGCC
GGGAGAGAAGGGCAGTCCAGGCCTTTATCTACTGCCCTTTCCTACCTTCTTTTATTTCACACCTTCTTTACCCTAAATCA
TAAGAGATGGTGCCCAGGTGGATGTGGTGTCCATCTCATTCCTGTCTTTCTGAGGCACTGTGATCACCCCTTCAGCTGCA
GGACTGGAATTCCCGTGGGGATCGCACAGTGCTGGTGATTGCTCACAGGCTGCAGACAGTTCAGCGCGCCCACCAGATCC
TGGTGCTCCAGGAGGGCAAGCTGCAGAAGCTTGCCCAGCTCTAGGAGGGACAGGACCTCTATTCCCGCCTGGTGCAGCAG
CGGCTGATGGACTGAGGCCCCAGGGATACTGGGCCCTCTTCTCAGGGGCGTCTCCAGGACCCAGAGCTGTTCCTGCTTTG
AGTTTCCCTAGAGCTGTGCGGCCAGATAGCTGTTCCTGAGTTGCAGGCACGATGGAGATTTGGACACTGTGTGCTTTTGG
TGGGGTAGAGAGGTGGGGTGGGGTGGGGTGGGGGCTGTCTGTGTCCAGGAAACTTAATTCCCTGGTGACTAGAGCTTTGC
CTGGTGATGAGGAGTATTTTGTGGCATAATACATATATTTTAAAATATTTTCCTTCTTACATGAACTGTATACATTCATA
TAGAAAATTTAGACAATATAAAAAAGTACAAAGAAGAAAAGTAAAAGTACCCATTGTTTCACTTCCTGGAGATAACCATA
GTTGCTATTTTGCTGCCTGTCCCATCAGTCGTTTATCTGTTGTTTG

IMGT/HLA

Sponsors

Animated Sponsors Logo