Allele Report for TAP2*01:01:01

TAP2*01:01:01 View HGVS Report
Pre-2010 Nomenclature: TAP2*0101 Local Names: RING11A / TAP2A
IMGT/HLA Acc No: HLA00959 OMIM Entry: *170261
Assigned: 1993-03-03 Sequence Last Modified: 1999-10-19
Source Entries: M84748  
Cells Sequence Derived From: CEM-CCRF  
Known Ethnic Origin Of Source: Caucasoid
Publications
Powis SH et al. Proc Natl Acad Sci U S A 89:1463-7 1992. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (686 aa)
MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLCLATPLTVSLR
ALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLV
LAVLGETLIPHYSGRVIDILGGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINLRIREQLFSSLLRQDLGF
FQETKTGELNSRLSSDTTLMSNWLPLNANVLLRSLVKVVGLYGFMLSISPRLTLLSLLHMPFTIAAEKVYNTRHQEVLRE
IQDAVARAGQVVREAVGGLQTVRSFGAEEHEVCRYKEALEQCRQLYWRRDLERALYLLVRRVLHLGVQMLMLSCGLQQMQ
DGELTQGSLLSFMIYQESVGSYVQTLVYIYGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNR
PDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSV
RNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQ
CEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL
Nucleotide Sequence Data (2061 bps)
ATGCGGCTCCCTGACCTGAGACCCTGGACCTCCCTGCTGCTGGTGGACGCGGCTTTACTGTGGCTGCTTCAGGGCCCTCT
GGGGACTTTGCTTCCTCAAGGGCTGCCAGGACTATGGCTGGAGGGGACCCTGCGGCTGGGAGGGCTGTGGGGGCTGCTAA
AGCTAAGAGGGCTGCTGGGATTTGTGGGGACACTGCTGCTCCCGCTCTGTCTGGCCACCCCCCTGACTGTCTCCCTGAGA
GCCCTGGTCGCGGGGGCCTCACGTGCTCCCCCAGCCAGAGTCGCTTCAGCCCCTTGGAGCTGGCTGCTGGTGGGGTACGG
GGCTGCGGGGCTCAGCTGGTCACTGTGGGCTGTTCTGAGCCCTCCTGGAGCCCAGGAGAAGGAGCAGGACCAGGTGAACA
ACAAAGTCTTGATGTGGAGGCTGCTGAAGCTCTCCAGGCCGGACCTGCCTCTCCTCGTTGCCGCCTTCTTCTTCCTTGTC
CTTGCTGTCTTGGGTGAGACATTAATCCCTCACTATTCTGGTCGTGTGATTGACATCCTGGGAGGTGATTTTGACCCCCA
TGCCTTTGCCAGTGCCATCTTCTTCATGTGCCTCTTCTCCTTTGGCAGCTCACTGTCTGCAGGCTGCCGAGGAGGCTGCT
TCACCTACACCATGTCTCGAATCAACTTGCGGATCCGGGAGCAGCTTTTCTCCTCCCTGCTGCGCCAGGACCTCGGTTTC
TTCCAGGAGACTAAGACAGGGGAGCTGAACTCACGGCTGAGCTCGGATACCACCCTGATGAGTAACTGGCTTCCTTTAAA
TGCCAATGTGCTCTTGCGAAGCCTGGTGAAAGTGGTGGGGCTGTATGGCTTCATGCTCAGCATATCGCCTCGACTCACCC
TCCTTTCTCTGCTGCACATGCCCTTCACAATAGCAGCGGAGAAGGTGTACAACACCCGCCATCAGGAAGTGCTTCGGGAG
ATCCAGGATGCAGTGGCCAGGGCGGGGCAGGTGGTGCGGGAAGCCGTTGGAGGGCTGCAGACCGTTCGCAGTTTTGGGGC
CGAGGAGCATGAAGTCTGTCGCTATAAAGAGGCCCTTGAACAATGTCGGCAGCTGTATTGGCGGAGAGACCTGGAACGCG
CCTTGTACCTGCTCGTAAGGAGGGTGCTGCACTTGGGGGTGCAGATGCTGATGCTGAGCTGTGGGCTGCAGCAGATGCAG
GATGGGGAGCTCACCCAGGGCAGCCTGCTTTCCTTTATGATCTACCAGGAGAGCGTGGGGAGCTATGTGCAGACCCTGGT
ATACATATATGGGGATATGCTCAGCAACGTGGGAGCTGCAGAGAAGGTTTTCTCCTACATGGACCGACAGCCAAATCTGC
CTTCACCTGGCACGCTTGCCCCCACCACTCTGCAGGGGGTTGTGAAATTCCAAGACGTCTCCTTTGCATATCCCAATCGC
CCTGACAGGCCTGTGCTCAAGGGGCTGACGTTTACCCTACGTCCTGGTGAGGTGACGGCGCTGGTGGGACCCAATGGGTC
TGGGAAGAGCACAGTGGCTGCCCTGCTGCAGAATCTGTACCAGCCCACAGGGGGACAGGTGCTGCTGGATGAAAAGCCCA
TCTCACAGTATGAACACTGCTACCTGCACAGCCAGGTGGTTTCAGTTGGGCAGGAGCCTGTGCTGTTCTCCGGTTCTGTG
AGGAACAACATTGCTTATGGGCTGCAGAGCTGCGAAGATGATAAGGTGATGGCGGCTGCCCAGGCTGCCCACGCAGATGA
CTTCATCCAGGAAATGGAGCATGGAATATACACAGATGTAGGGGAGAAGGGAAGCCAGCTGGCTGCGGGACAGAAACAAC
GTCTGGCCATTGCCCGGGCCCTTGTACGAGACCCGCGGGTCCTCATCCTGGATGAGGCTACTAGTGCCCTAGATGTGCAG
TGCGAGCAGGCCCTGCAGGACTGGAATTCCCGTGGGGATCGCACAGTGCTGGTGATTGCTCACAGGCTGCAGACAGTTCA
GCGCGCCCACCAGATCCTGGTGCTCCAGGAGGGCAAGCTGCAGAAGCTTGCCCAGCTCTAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo