Allele Report for MICA*059

MICA*059 View HGVS Report
Pre-2010 Nomenclature: MICA*059 Local Names: MICA
IMGT/HLA Acc No: HLA04350 OMIM Entry: *600169
Assigned: 2009-09-30 Sequence Last Modified: 2009-10-19
Source Entries: GQ351696  
Cells Sequence Derived From: XW  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Tian W et al. Human Immunology 71:423-427 2010. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (273 aa)
PHSLRYNLTVLSWDGSVQSGFLAEGHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIK
DQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMH
ADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTY
QTWVATRICEGEEQRFTCYMEHSGNHSTHPVPS
Nucleotide Sequence Data (822 bps)
AGCCCCACAGTCTTCGTTATAACCTCACGGTGCTGTCCTGGGATGGATCTGTGCAGTCAGGGTTTCTCGCTGAGGGACAT
CTGGATGGTCAGCCCTTCCTGCGCTGTGACAGGCAGAAATGCAGGGCAAAGCCCCAGGGACAGTGGGCAGAAGATGTCCT
GGGAAATAAGACATGGGACAGAGAGACCAGGGACTTGACAGGGAACGGAAAGGACCTCAGGATGACCCTGGCTCATATCA
AGGACCAGAAAGAAGGCTTGCATTCCCTCCAGGAGATTAGGGTCTGTGAGATCCATGAAGACAACAGCACCAGGAGCTCC
CAGCATTTCTACTACGATGGGGAGCTCTTCCTCTCCCAAAACCTGGAGACTGAGGAATGGACAATGCCCCAGTCCTCCAG
AGCTCAGACCTTGGCCATGAACGTCAGGAATTTCTTGAAGGAAGATGCCATGAAGACCAAGACACACTATCACGCTATGC
ATGCAGACTGCCTGCAGGAACTACGGCGATATCTAAAATCCGGCGTAGTCCTGAGGAGAACAGTGCCCCCCATGGTGAAT
GTCACCCGCAGTGAGGCCTCAGAGGGCAACATTACCGTGACATGCAGGGCTTCTGGCTTCTATCCCTGGAATATCACACT
GAGCTGGCGTCAGGATGGGGTATCTTTGAGCCACGACACCCAGCAGTGGGGGGATGTCCTGCCTGATGGGAATGGAACCT
ACCAGACCTGGGTGGCCACCAGGATTTGCGAAGGAGAGGAGCAGAGGTTCACCTGCTACATGGAACACAGCGGGAATCAC
AGCACTCACCCTGTGCCCTCTG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo