Allele Report for MICA*017

MICA*017 View HGVS Report
Pre-2010 Nomenclature: MICA*017 Local Names: MICA-KMCE
IMGT/HLA Acc No: HLA01335 OMIM Entry: *600169
Assigned: 2000-10-23 Sequence Last Modified: 2013-04-17
Source Entries: AF079413 , AF079414 , AF079415 , AF097403 , AF264735 , AF264736 , AF264737 , AH006330 , AH010819 , AJ250803 , Y16810  
Cells Sequence Derived From: DBB , DEM , DEU , FD(F)-MUC , FM(child1)-MUC , HF(M)-MUC , HS(child1)-MUC , HT(child2)-MUC , KSM , Thai-DCH013 , Thai-DCH020 , Thai-DCH024 , WJR076  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
Perez-Rodriguez M et al. Eur J Immunogenet 29:35-46 2002. (View abstract)
Fodil N et al. Immunogenetics 49:557-60 1999. (View abstract)
Petersdorf EW et al. Immunogenetics 49:605-12 1999. (View abstract)
Yao Z et al. Eur J Immunogenet 26:225-32 1999. (View abstract)
Obuchi N et al. Tissue Antigens 57:520-35 2001. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 13 Laboratories: 5
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (349 aa)
MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSGDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNK
TWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLREIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQT
LAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWR
QDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKCWCFRVIGRHSMFLLLLLLLL
LLLLFLLLLFSTSVVVRRKHQLQRVQSSX
Nucleotide Sequence Data (1166 bps)
ATGGGGCTGGGCCCGGTCTTCCTGCTTCTGGCTGGCATCTTCCCTTTTGCACCTCCGGGAGCTGCTGCTGAGCCCCACAG
TCTTCGTTATAACCTCACGGTGCTGTCCGGGGATGGATCTGTGCAGTCAGGGTTTCTCGCTGAGGTACATCTGGATGGTC
AGCCCTTCCTGCGCTGTGACAGGCAGAAATGCAGGGCAAAGCCCCAGGGACAGTGGGCAGAAGATGTCCTGGGAAATAAG
ACATGGGACAGAGAGACCAGGGACTTGACAGGGAACGGAAAGGACCTCAGGATGACCCTGGCTCATATCAAGGACCAGAA
AGAAGGCTTGCATTCCCTCCGGGAGATTAGGGTCTGTGAGATCCATGAAGACAACAGCACCAGGAGCTCCCAGCATTTCT
ACTACGATGGGGAGCTCTTCCTCTCCCAAAACCTGGAGACTGAGGAATGGACAATGCCCCAGTCCTCCAGAGCTCAGACC
TTGGCCATGAACGTCAGGAATTTCTTGAAGGAAGATGCCATGAAGACCAAGACACACTATCACGCTATGCATGCAGACTG
CCTGCAGGAACTACGGCGATATCTAAAATCCGGCGTAGTCCTGAGGAGAACAGTGCCCCCCATGGTGAATGTCACCCGCA
GCGAGGCCTCAGAGGGCAACATTACCGTGACATGCAGGGCTTCTGGCTTCTATCCCTGGAATATCACACTGAGCTGGCGT
CAGGATGGGGTATCTTTGAGCCACGACACCCAGCAGTGGGGGGATGTCCTGCCTGATGGGAATGGAACCTACCAGACCTG
GGTGGCCACCAGGATTTGCCAAGGAGAGGAGCAGAGGTTCACCTGCTACATGGAACACAGCGGGAATCACAGCACTCACC
CTGTGCCCTCTGGAAAGTGCTGGTGCTTCAGAGTCATTGGCAGACATTCCATGTTTCTGCTGTTGCTGCTGCTGCTGCTG
CTGCTGCTGCTATTTTTGTTATTATTATTTTCTACGTCTGTTGTTGTAAGAAGAAAACATCAGCTGCAGAGGGTCCAGAG
CTCGTGAGCCTGCAGGTCCTGGATCAACACCCAGTTGGGACGAGTGACCACAGGGATGCCACACAGCTCGGATTTCAGCC
TCTGATGTCAGATCTTGGGTCCACTGGCTCCACTGAGGGCGCCTAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo