Allele Report for MICA*016

MICA*016 View HGVS Report
Pre-2010 Nomenclature: MICA*016 Local Names: MICA016, PERB11.1-35.1
IMGT/HLA Acc No: HLA01027 OMIM Entry: *600169
Assigned: 1998-10-10 Sequence Last Modified: 2002-07-15
Source Entries: AF085027 , AF085028 , AF085029 , AF085030 , AF336075 , AF336076 , AH008140 , AH010560 , U56955 , U69623 , U69966 , Y16802  
Cells Sequence Derived From: FPAF , J0528239 , NM(Child2)-MUC , NR(Child1)-MUC , NR(M)-MUC , Q85/8086 , TISI  
Known Ethnic Origin Of Source: Caucasoid
Publications
Fodil N et al. Immunogenetics 44:351-7 1996. (View abstract)
Gaudieri S et al. Immunogenetics 45:209-16 1997. (View abstract)
Visser CJ et al. Immunogenetics 49:561-6 1999. (View abstract)
Yao Z et al. Eur J Immunogenet 26:225-32 1999. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 7 Laboratories: 5
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (360 aa)
PHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIK
DQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMH
ADCLQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGLSLSHDTQQWGDVLPDGNGTY
QTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAAIFVIIIFYVRCCKKKTSAAEGPEL
VSLQVLDQHPVGTSDHRDATQLGFQPLMSALGSTGSTEGA
Nucleotide Sequence Data (1085 bps)
AGCCCCACAGTCTTCGTTATAACCTCACGGTGCTGTCCTGGGATGGATCTGTGCAGTCAGGGTTTCTTGCTGAGGTACAT
CTGGATGGTCAGCCCTTCCTGCGCTATGACAGGCAGAAATGCAGGGCAAAGCCCCAGGGACAGTGGGCAGAAGATGTCCT
GGGAAATAAGACATGGGACAGAGAGACCAGGGACTTGACAGGGAACGGAAAGGACCTCAGGATGACCCTGGCTCATATCA
AGGACCAGAAAGAAGGCTTGCATTCCCTCCAGGAGATTAGGGTCTGTGAGATCCATGAAGACAACAGCACCAGGAGCTCC
CAGCATTTCTACTACGATGGGGAGCTCTTCCTCTCCCAAAACCTGGAGACTGAGGAATGGACAGTGCCCCAGTCCTCCAG
AGCTCAGACCTTGGCCATGAACGTCAGGAATTTCTTGAAGGAAGATGCCATGAAGACCAAGACACACTATCACGCTATGC
ATGCAGACTGCCTGCAGGAACTACGGCGATATCTAGAATCCAGCGTAGTCCTGAGGAGAACAGTGCCCCCCATGGTGAAT
GTCACCCGCAGCGAGGCCTCAGAGGGCAACATCACCGTGACATGCAGGGCTTCCAGCTTCTATCCCCGGAATATCATACT
GACCTGGCGTCAGGATGGGCTATCTTTGAGCCACGACACCCAGCAGTGGGGGGATGTCCTGCCTGATGGGAATGGAACCT
ACCAGACCTGGGTGGCCACCAGGATTTGCCGAGGAGAGGAGCAGAGGTTCACCTGCTACATGGAACACAGCGGGAATCAC
AGCACTCACCCTGTGCCCTCTGGGAAAGTGCTGGTGCTTCAGAGTCATTGGCAGACATTCCATGTTTCTGCTGTTGCTGC
TGCTGCTGCTATTTTTGTTATTATTATTTTCTATGTCCGTTGTTGTAAGAAGAAAACATCAGCTGCAGAGGGTCCAGAGC
TCGTGAGCCTGCAGGTCCTGGATCAACACCCAGTTGGGACGAGTGACCACAGGGATGCCACACAGCTCGGATTTCAGCCT
CTGATGTCAGCTCTTGGGTCCACTGGCTCCACTGAGGGCGCCTAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo