Allele Report for MICA*009:02

MICA*009:02 View HGVS Report
Pre-2010 Nomenclature: MICA*00902 Local Names: MICA-AFC allele.
IMGT/HLA Acc No: HLA01397 OMIM Entry: *600169
Assigned: 2000-12-11 Sequence Last Modified: 2001-07-09
Source Entries: AF011886 , AF011887 , AF011888 , AF079419 , AF079420 , AF079421 , AF097406 , AH006332 , AH007185 , AH010740 , AY029762 , AY029763 , Y16803  
Cells Sequence Derived From: AE(F)-MUC , AS(child2)-MUC , DZA 97-19 , MANIKA , TAA  
Known Ethnic Origin Of Source: Caucasoid
Publications
Visser CJ et al. Immunogenetics 49:561-6 1999. (View abstract)
Fodil N et al. Immunogenetics 49:557-60 1999. (View abstract)
Petersdorf EW et al. Immunogenetics 49:605-12 1999. (View abstract)
Yao Z et al. Eur J Immunogenet 26:225-32 1999. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 5 Laboratories: 5
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (361 aa)
PHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIK
DQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNVETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMH
ADCLQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNITLTWRQDGVSLSHDTQQWGDVLPDGNGTY
QTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAAAIFVIIIFYVRCCKKKTSAAEGPE
LVSLQVLDQHPVGTSDHRDATQLGFQPLMSALGSTGSTEGA
Nucleotide Sequence Data (1088 bps)
AGCCCCACAGTCTTCGTTATAACCTCACGGTGCTGTCCTGGGATGGATCTGTGCAGTCAGGGTTTCTTGCTGAGGTACAT
CTGGATGGTCAGCCCTTCCTGCGCTATGACAGGCAGAAATGCAGGGCAAAGCCCCAGGGACAGTGGGCAGAAGATGTCCT
GGGAAATAAGACATGGGACAGAGAGACCAGGGACTTGACAGGGAACGGAAAGGACCTCAGGATGACCCTGGCTCATATCA
AGGACCAGAAAGAAGGCTTGCATTCCCTCCAGGAGATTAGGGTCTGTGAGATCCATGAAGACAACAGCACCAGGAGCTCC
CAGCATTTCTACTATGATGGGGAGCTCTTCCTCTCCCAAAACGTGGAGACTGAGGAATGGACAGTGCCCCAGTCCTCCAG
AGCTCAGACCTTGGCCATGAACGTCAGGAATTTCTTGAAGGAAGATGCCATGAAGACCAAGACACACTATCACGCTATGC
ATGCAGACTGCCTGCAGGAACTACGGCGATATCTAGAATCCAGCGTAGTCCTGAGGAGAACAGTGCCCCCCATGGTGAAT
GTCACCCGCAGCGAGGCCTCAGAGGGCAACATCACCGTGACATGCAGGGCTTCCAGCTTCTATCCCCGGAATATCACACT
GACCTGGCGTCAGGATGGGGTATCTTTGAGCCACGACACCCAGCAGTGGGGGGATGTCCTGCCTGATGGGAATGGAACCT
ACCAGACCTGGGTGGCCACCAGGATTTGCCAAGGAGAGGAGCAGAGGTTCACCTGCTACATGGAACACAGCGGGAATCAC
AGCACTCACCCTGTGCCCTCTGGGAAAGTGCTGGTGCTTCAGAGTCATTGGCAGACATTCCATGTTTCTGCTGTTGCTGC
TGCTGCTGCTGCTATTTTTGTTATTATTATTTTCTATGTCCGTTGTTGTAAGAAGAAAACATCAGCTGCAGAGGGTCCAG
AGCTCGTGAGCCTGCAGGTCCTGGATCAACACCCAGTTGGGACGAGTGACCACAGGGATGCCACACAGCTCGGATTTCAG
CCTCTGATGTCAGCTCTTGGGTCCACTGGCTCCACTGAGGGCGCCTAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo