Allele Report for MICA*009:01

MICA*009:01 View HGVS Report
Pre-2010 Nomenclature: MICA*00901 Local Names: MICA009, PERB11.1-52.1
IMGT/HLA Acc No: HLA01020 OMIM Entry: *600169
Assigned: 1998-10-10 Sequence Last Modified: 2001-07-09
Source Entries: AB103614 , AF085019 , AF085020 , AF085021 , AF085022 , AF336069 , AF336070 , AH008138 , AH010569 , U56948 , U69626 , U69971  
Cells Sequence Derived From: AKIBA , BOB , C1R , E4181324 , HARA , Individual2 , JHAF , LUY , RML  
Known Ethnic Origin Of Source: American Indian, Caucasoid, Oriental
Publications
Fodil N et al. Immunogenetics 44:351-7 1996. (View abstract)
Gaudieri S et al. Immunogenetics 45:209-16 1997. (View abstract)
Visser CJ et al. Immunogenetics 49:561-6 1999. (View abstract)
Obuchi N et al. Tissue Antigens 57:520-35 2001. (View abstract)
Shiina T et al. Genetics 173:1555-70 2006. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 9 Laboratories: 5
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (361 aa)
PHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIK
DQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNVETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMH
ADCLQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNITLTWRQDGVSLSHDTQQWGDVLPDGNGTY
QTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAAAIFVIIIFYVRCCKKKTSAAEGPE
LVSLQVLDQHPVGTSDHRDATQLGFQPLMSALGSTGSTEGA
Nucleotide Sequence Data (1088 bps)
AGCCCCACAGTCTTCGTTATAACCTCACGGTGCTGTCCTGGGATGGATCTGTGCAGTCAGGGTTTCTTGCTGAGGTACAT
CTGGATGGTCAGCCCTTCCTGCGCTATGACAGGCAGAAATGCAGGGCAAAGCCCCAGGGACAGTGGGCAGAAGATGTCCT
GGGAAATAAGACATGGGACAGAGAGACCAGGGACTTGACAGGGAACGGAAAGGACCTCAGGATGACCCTGGCTCATATCA
AGGACCAGAAAGAAGGCTTGCATTCCCTCCAGGAGATTAGGGTCTGTGAGATCCATGAAGACAACAGCACCAGGAGCTCC
CAGCATTTCTACTACGATGGGGAGCTCTTCCTCTCCCAAAACGTGGAGACTGAGGAATGGACAGTGCCCCAGTCCTCCAG
AGCTCAGACCTTGGCCATGAACGTCAGGAATTTCTTGAAGGAAGATGCCATGAAGACCAAGACACACTATCACGCTATGC
ATGCAGACTGCCTGCAGGAACTACGGCGATATCTAGAATCCAGCGTAGTCCTGAGGAGAACAGTGCCCCCCATGGTGAAT
GTCACCCGCAGCGAGGCCTCAGAGGGCAACATCACCGTGACATGCAGGGCTTCCAGCTTCTATCCCCGGAATATCACACT
GACCTGGCGTCAGGATGGGGTATCTTTGAGCCACGACACCCAGCAGTGGGGGGATGTCCTGCCTGATGGGAATGGAACCT
ACCAGACCTGGGTGGCCACCAGGATTTGCCAAGGAGAGGAGCAGAGGTTCACCTGCTACATGGAACACAGCGGGAATCAC
AGCACTCACCCTGTGCCCTCTGGGAAAGTGCTGGTGCTTCAGAGTCATTGGCAGACATTCCATGTTTCTGCTGTTGCTGC
TGCTGCTGCTGCTATTTTTGTTATTATTATTTTCTATGTCCGTTGTTGTAAGAAGAAAACATCAGCTGCAGAGGGTCCAG
AGCTCGTGAGCCTGCAGGTCCTGGATCAACACCCAGTTGGGACGAGTGACCACAGGGATGCCACACAGCTCGGATTTCAG
CCTCTGATGTCAGCTCTTGGGTCCACTGGCTCCACTGAGGGCGCCTAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo