Allele Report for G*01:14

G*01:14 View HGVS Report
Pre-2010 Nomenclature: G*0114 Local Names: 508-2464HLA-G
IMGT/HLA Acc No: HLA03398 OMIM Entry: *142871
Assigned: 2008-06-30 Sequence Last Modified: 2008-10-10
Source Entries: EU750735  
Cells Sequence Derived From: 9b007 , BCCR498 , HLA4  
Known Ethnic Origin Of Source: Black, Caucasoid
Publications
Lajoie J et al. Tissue Antigens 72:491-505 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (273 aa)
SHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTL
RGYYNQSEASSHTLQWMIDCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLE
GTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQQDGEDQTQDVELVETRPAGDGTF
QKWAAVVVPSGEEQRYMCHVQHEGLPEPLMLRW
Nucleotide Sequence Data (822 bps)
GCTCCCACTCCATGAGGTATTTCAGCGCCGCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCATGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACTCGGCGTGTCCGAGGATGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCAGAGTATTGGGAAGAGGAGACACGGAACACCAAGGCCCACGCACAGACTGACAGAATGAACCTGCAGACCC
TGCGCGGCTACTACAACCAGAGCGAGGCCAGTTCTCACACCCTCCAGTGGATGATTGACTGCGACCTGGGGTCCGACGGA
CGCCTCCTCCGCGGGTATGAACAGTATGCCTACGATGGCAAGGATTACCTCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCAGCGGACACTGCGGCTCAGATCTCCAAGCGCAAGTGTGAGGCGGCCAATGTGGCTGAACAAAGGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCACAGATACCTGGAGAACGGGAAGGAGATGCTGCAGCGCGCGGACCCCCCCAAGACA
CACGTGACCCACCACCCTGTCTTTGACTATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCAT
ACTGACCTGGCAGCAGGATGGGGAGGACCAGACCCAGGACGTGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCT
TCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAGGAGCAGAGATACATGTGCCATGTGCAGCATGAGGGGCTGCCG
GAGCCCCTCATGCTGAGATGGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo