Allele Report for G*01:09

G*01:09 View HGVS Report
Pre-2010 Nomenclature: G*0109 Local Names: HLA-G JKKB-28
IMGT/HLA Acc No: HLA02969 OMIM Entry: *142871
Assigned: 2007-05-31 Sequence Last Modified: 2007-07-09
Source Entries: EF218655  
Cells Sequence Derived From: JKKB-28  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Kang H et al. Tissue Antigens 70:529-30 2007. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTL
RGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAHLE
GTCVEWLHRYLENGKEMLQRA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCAGCGCCGCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCATGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACTCGGCGTGTCCGAGGATGGAGCCGCGGGCGCCGTGGGTGGAGCA
GGAGGGGCCAGAGTATTGGGAAGAGGAGACACGGAACACCAAGGCCCACGCACAGACTGACAGAATGAACCTGCAGACCC
TGCGCGGCTACTACAACCAGAGCGAGGCCAGTTCTCATACCCTCCAGTGGATGATTGGCTGCGACCTGGGGTCCGACGGA
CGCCTCCTCCGCGGGTATGAACAGTATGCCTACGATGGCAAGGATTACCTCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCAGCGGACACTGCGGCTCAGATCTCCAAGCGCAAGTGTGAGGCGGCCAATGTGGCTGAACAAAGGAGAGCCCACCTGG
AGGGCACGTGCGTGGAGTGGCTCCACAGATACCTGGAGAACGGGAAGGAGATGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo