Allele Report for G*01:01:12

G*01:01:12 View HGVS Report
Pre-2010 Nomenclature: G*010112 Local Names: HLAG JKKB-55
IMGT/HLA Acc No: HLA02972 OMIM Entry: *142871
Assigned: 2007-05-31 Sequence Last Modified: 2009-04-17
Source Entries: BX247949 , EF218653  
Cells Sequence Derived From: JKKB-55 , SSTO  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
Kim JG et al. Tissue Antigens 73:281-3 2009. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (338 aa)
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEG
PEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAA
DTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILT
WQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAA
VVTGAAVAAVLWRKKSSD
Nucleotide Sequence Data (1017 bps)
ATGGTGGTCATGGCACCCCGAACCCTCTTCCTGCTACTCTCGGGGGCCCTGACCCTGACCGAGACCTGGGCGGGCTCCCA
CTCCATGAGGTATTTCAGCGCCGCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCATGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACTCGGCTTGTCCGAGGATGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCAGAGTATTGGGAAGAGGAGACACGGAACACCAAGGCCCACGCACAGACTGACAGAATGAACCTGCAGACCCTGCGCGG
CTACTACAACCAGAGCGAGGCCAGTTCTCATACCCTCCAGTGGATGATTGGCTGCGACCTGGGGTCCGACGGACGCCTCC
TCCGCGGGTATGAACAGTATGCCTACGATGGCAAGGATTACCTCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCAGCG
GACACTGCGGCTCAGATCTCCAAGCGCAAGTGTGAGGCGGCCAATGTGGCTGAACAAAGGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCACAGATACCTGGAGAACGGGAAGGAGATGCTGCAGCGCGCGGACCCCCCCAAGACACACGTGA
CCCACCACCCTGTCTTTGACTATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCATACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACGTGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAGGAGCAGAGATACACGTGCCATGTGCAGCATGAGGGGCTGCCGGAGCCCC
TCATGCTGAGATGGAAGCAGTCTTCCCTGCCCACCATCCCCATCATGGGTATCGTTGCTGGCCTGGTTGTCCTTGCAGCT
GTAGTCACTGGAGCTGCGGTCGCTGCTGTGCTGTGGAGGAAGAAGAGCTCAGATTGA
Genomic Sequence Data (3138 bps)
TGAGACAGAACGCTTGGCACAAGAGTAGCGGGGTCAGGGCGAAGTCCCAGGGCCTCAAGCGTGGCTCTCAGGGTCTCAGG
CCCCACAGGCGGTGTATGGATTGGGGAGGCCCCGCGTTGGGGATTCTCTCCTCCTTCTCCTAACCTGTGTCGGGTCCTTC
TTCCTGGATACTCACCGGGCGGCCCCAGTTCTCACTCCCATTAGGTGACAGGTTTTTAGAGAAGCCAATCAGCGTCGCCG
CGGTCCTGGTTCTAAAGTCCTCGCTCACCCACCCGGACTCATTCTCCCCAGACGCCAAGGATGGTGGTCATGGCACCCCG
AACCCTCTTCCTGCTACTCTCGGGGGCCCTGACCCTGACCGAGACCTGGGCGGGTGAGTGCGGGGTCAGGAGGGAAACGG
CCCCTGCGCGGAGGAGGGAGGGGCCGGCCCGGCGGGGGCGCAGGACCCGGCAGCCGCGCCGGGAGGAGGGTCGGGCGGGT
CTCAACCTCTCCTCGCCCCCAGGCTCCCACTCCATGAGGTATTTCAGCGCCGCCGTGTCCCGGCCCGGCCGCGGGGAGCC
CCGCTTCATCGCCATGGGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACTCGGCTTGTCCGAGGATGGAGC
CGCGGGCGCCGTGGGTGGAGCAGGAGGGGCCAGAGTATTGGGAAGAGGAGACACGGAACACCAAGGCCCACGCACAGACT
GACAGAATGAACCTGCAGACCCTGCGCGGCTACTACAACCAGAGCGAGGCCAGTGAGTAACCCCGGCCCAGGGCGCAGAT
CACGACCCCCCACCTCCATGCCCCACGGACGCCCCGGGTACTCCCGAGTCTCCGGGTCTGGGATCCACCCCGAGGCCGCG
GGACCCGCCCAGACCCTCTACCTGGGAGAACCCCAGGCGCCTTTACCAAAATCCCTGCGGGTGGGTCCGGGCGAGGGCGA
GGCTCGGTGGGCGGGGCTGACCGAAGGGGTGGGGCCAGGTTCTCATACCCTCCAGTGGATGATTGGCTGCGACCTGGGGT
CCGACGGACGCCTCCTCCGCGGGTATGAACAGTATGCCTACGATGGCAAGGATTACCTCGCCCTGAACGAGGACCTGCGC
TCCTGGACCGCAGCGGACACTGCGGCTCAGATCTCCAAGCGCAAGTGTGAGGCGGCCAATGTGGCTGAACAAAGGAGAGC
CTACCTGGAGGGCACGTGCGTGGAGTGGCTCCACAGATACCTGGAGAACGGGAAGGAGATGCTGCAGCGCGCGGGTACCA
GGGGCAGTGGGGCGCCTCCCTGATCTCCTGTAGACCTCCCAGCCTGGCCTAGCACAAGGAGAGGAGGAAAATGGGACCAA
CACCAGAATATCGCCCTCCCTCTGGTCCTGAGGGAGAGGAATCCTCCTGGGTTTCCAGATCCTGTACCAGAGAGTGATTC
TGAGGGCCCGTCCTGCTCTCTGGGACAATTAAGGGATGAAGTCTCTGAGGGAGTGGAGGGGAAGACAATCCCTGGAGGAC
TGATCAGGGGTTCCCTTTGACCCCACAGCAGCCTTGGCACCAGGACTTTTCCCCTCAGGCCTTGTTCTCTGCCTCACACT
CAATGTGTGTGGGAGTCTGACTCCAGCTCCTCTGAGTCCCTTGGCCTCCACTCAGGTCAGAACCAGAGGTCCCTGCTCCC
CCGCTCAGAGACTAGAACTTTCCAAGGAATAGGAGATTATCCCAGGTGCCCGTGTCCAGGCTGGTGTCTGGGTTCTGTGC
TCCCTTCCCCACCCCAGGTATCTGGTTCATTCTTAGGATGGTCACATCCAGGTGCTGCTGGAGTGTCCCATGAGAGATGC
AAAGTGCTTGAGTTTTCTGACTCTTCCTTTCAGACCCCCCCAAGACACACGTGACCCACCACCCTGTCTTTGACTATGAG
GCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCATACTGACCTGGCAGCGGGATGGGGAGGACCAGAC
CCAGGACGTGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTG
GAGAGGAGCAGAGATACACGTGCCATGTGCAGCATGAGGGGCTGCCGGAGCCCCTCATGCTGAGATGGAGTAAGGAGGGA
GATGGAGGCATCATGTCTGTTAGGGAAAGCAGGAGCCTCTCTGAAGACCTTTAACAGGGTCGGTGGTGAGGCCTGGGGGT
CAGAGACCCTCACCTTCACCTCCTTTCCCAGAGCAGTCTTCCCTGCCCACCATCCCCATCATGGGTATCGTTGCTGGCCT
GGTTGTCCTTGCAGCTGTAGTCACTGGAGCTGCGGTCGCTGCTGTGCTGTGGAGGAAGAAGAGCTCAGGTAAGGAAGGGG
TGACAAGTGGGGTCTGAGTTTTCTTGTCCCACTGGGGGTTTCAAGCCCCAGGTAGAAGTGCGCCCTGCCTGGTTACTGGG
AAGCACCATCCACACTCATGGGCCTACCCAGCCTGGGCCCTGTGTGCCAGCACCTTCTCTTTTGTAAAGCACCTGTGACA
ATGAAGGACAGATTTATCACCTTGATGATTGTAGTGATGGGGACCTGATCCTAGTAATCACAGGTCAGGGGAAGGTCCCT
GGCTAAGGACAGACCTTAGGAGGGCAGTTGGTCGAGGACCCACATCTGCTTTCCTTGTTTTTCCTGATCCCGCCCTGAGT
CTGCAGTCACACATTTCTGGAAACTTCTCGAGGGTCCAAGACTAGGAGGTTCCTCTAGGACCTCATGGCCCTGCCACCTT
TCTGGCCTCTCACAGGACATTTTCTTCCCACAGATTGAAAAGGAGGGAGCTACTCTCAGGCTGCAAGTAAGTATGAAGGA
GGCTGATCCCTGAGATCCTTGGGATCTTGTGTTTGGGAGCCCATGGGGGAGCTCACCCACCCCACAATTCCTCCTCTGGC
CACATCTCCTGTGGTCTCTGACCAGGTGCTGTTTTTGTTCTACTCTAGGCAGTGACAGTGCCCAGGGCTCTAATGTGTCT
CTCACGGCTTGTAAATGTGACACCCCGGGGGGCCTGATGTGTGTGGGTTGTTGAGGGGAACAGTGGACATAGCTGTGCTA
TGAGGTTTCTTTGACTTG

IMGT/HLA

Sponsors

Animated Sponsors Logo