Allele Report for G*01:01:03:02

G*01:01:03:02 View HGVS Report
Pre-2010 Nomenclature: G*01010302 Local Names: HLA-G*010103B
IMGT/HLA Acc No: HLA03807 OMIM Entry: *142871
Assigned: 2009-05-31 Sequence Last Modified: 2009-10-19
Source Entries: FJ805839  
Cells Sequence Derived From: CUI-65  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Cervera I et al. Tissue Antigens 74:463-464 2009. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (338 aa)
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEG
PEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAA
DTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILT
WQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAA
VVTGAAVAAVLWRKKSSD
Nucleotide Sequence Data (1017 bps)
ATGGTGGTCATGGCACCCCGAACCCTCTTCCTGCTACTCTCGGGGGCCCTGACCCTGACCGAGACCTGGGCGGGCTCCCA
CTCCATGAGGTATTTCAGCGCCGCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCATGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACTCGGCGTGTCCGAGGATGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCAGAGTATTGGGAAGAGGAGACACGGAACACCAAGGCCCACGCACAGACTGACAGAATGAACCTGCAGACCCTGCGCGG
CTACTACAACCAGAGCGAGGCCAGTTCTCACACCCTCCAGTGGATGATTGGCTGCGACCTGGGGTCCGACGGTCGCCTCC
TCCGCGGGTATGAACAGTATGCCTACGATGGCAAGGATTACCTCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCAGCG
GACACTGCGGCTCAGATCTCCAAGCGCAAGTGTGAGGCGGCCAATGTGGCTGAACAAAGGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCACAGATACCTGGAGAACGGGAAGGAGATGCTGCAGCGCGCGGACCCCCCCAAGACACACGTGA
CCCACCACCCTGTCTTTGACTATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCATACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACGTGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAGGAGCAGAGATACACGTGCCATGTGCAGCATGAGGGGCTGCCGGAGCCCC
TCATGCTGAGATGGAAGCAGTCTTCCCTGCCCACCATCCCCATCATGGGTATCGTTGCTGGCCTGGTTGTCCTTGCAGCT
GTAGTCACTGGAGCTGCGGTCGCTGCTGTGCTGTGGAGGAAGAAGAGCTCAGATTGA
Genomic Sequence Data (3098 bps)
GAAGTCCCAGGGCCTCAAGCGTGGCTCTCAGGGTCTCAGGCCCCACAGGCGGTGTATGGATTGGGGAGGCCCCGCGTTGG
GGATTCTCTCCTCCTTCTCCTAACCTGTGTCGGGTCCTTCTTCCTGGATACTCACCGGGCGGCCCCAGTTCTCACTCCCA
TTAGGTGACAGGTTTTTAGAGAAGCCAATCAGCGTCGCCGCGGTCCTGGTTCTAAAGTCCTCGCTCACCCACCCGGACTC
ATTCTCCCCAGACGCCAAGGATGGTGGTCATGGCACCCCGAACCCTCTTCCTGCTACTCTCGGGGGCCCTGACCCTGACC
GAGACCTGGGCGGGTGAGTGCGGGGTCAGGAGGGAAACGGCCCCTGCGCGGAGGAGGGAGGGGCCGGCCCGGCGGGGGCG
CAGGACCCGGCAGCCGCGCCGGGAGGAGGGTCGGGCGGGTCTCAACCCCTCCTCGCCCCCAGGCTCCCACTCCATGAGGT
ATTTCAGCGCCGCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCATGGGCTACGTGGACGACACGCAGTTC
GTGCGGTTCGACAGCGACTCGGCGTGTCCGAGGATGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGGCCAGAGTATTG
GGAAGAGGAGACACGGAACACCAAGGCCCACGCACAGACTGACAGAATGAACCTGCAGACCCTGCGCGGCTACTACAACC
AGAGCGAGGCCAGTGAGTAACCCCGGCCCAGGGCGCAGATCACGACCCCCCACCTCCATGCCCCACGGACGCCCCGGGTA
CTCCCGAGTCTCCGGGTCTGGGATCCACCCCGAGGCCGCGGGACCCGCCCAGACCCTCTACCTGGGAGAACCCCAGGCGC
CTTTACCAAAATCCCTGCGGGTGGGTCCGGGCGAGGGCGAGGCTCGGTGGGCGGGGCTGACCGAAGGGGTGGGGCCAGGT
TCTCACACCCTCCAGTGGATGATTGGCTGCGACCTGGGGTCCGACGGTCGCCTCCTCCGCGGGTATGAACAGTATGCCTA
CGATGGCAAGGATTACCTCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCAGCGGACACTGCGGCTCAGATCTCCAAGC
GCAAGTGTGAGGCGGCCAATGTGGCTGAACAAAGGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCACAGATAC
CTGGAGAACGGGAAGGAGATGCTGCAGCGCGCGGGTACCAGGGGCAGTGGGGCGCCTCCCTGATCTCCTGTAGACCTCCC
AGCCTGGCCTAGCACAAGGAGAGGAGGAAAATGGGACCAACACCAGAATATCGCCCTCCCTCTGGTCCTGAGGGAGAGGA
ATCCTCCTGGGTTTCCAGATCCTGTACCAGAGAGTGATTCTGAGGGCCCGTCCTGCTCTCTGGGACAATTAAGGGATGAA
GTCTCTGAGGGAGTGGAGGGGAAGACAATCCCTGGAGGACTGATCAGGGGTTCCCTTTGACCCCACAGCAGCCTTGGCAC
CAGGACTTTTCCCCTCAGGCCTTGTTCTCTGCCTCACACTCAATGTGTGTGGGAGTCTGACTCCAGCTCCTCTGAGTCCC
TTGGCCTCCACTCAGGTCAGAACCAGAGGTCCCTGCTCCCCCGCTCAGAGACTAGAACTTTCCAAGGAATAGGAGATTAT
CCCAGGTGCCCGTGTCCAGGCTGGTGTCTGGGTTCTGTGCTCCCTTCCCCACCCCAGGTATCTGGTTCATTCTTAGGATG
GTCACATCCAGGTGCTGCTGGAGTGTCCCATGAGAGATGCAAAGTGCTTGAGTTTTCTGACTCTTCCTTTCAGACCCCCC
CAAGACACACGTGACCCACCACCCTGTCTTTGACTATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGG
AGATCATACTGACCTGGCAGCGGGATGGGGAGGACCAGACCCAGGACGTGGAGCTCGTGGAGACCAGGCCTGCAGGGGAT
GGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAGGAGCAGAGATACACGTGCCATGTGCAGCATGAGGG
GCTGCCGGAGCCCCTCATGCTGAGATGGAGTAAGGAGGGAGATGGAGGCATCATGTCTGTTAGGGAAAGCAGGAGCCTCT
CTGAAGACCTTTAACAGGGTCGGTGGTGAGGCCTGGGGGTCAGAGACCCTCACCTTCACCTCCTTTCCCAGAGCAGTCTT
CCCTGCCCACCATCCCCATCATGGGTATCGTTGCTGGCCTGGTTGTCCTTGCAGCTGTAGTCACTGGAGCTGCGGTCGCT
GCTGTGCTGTGGAGGAAGAAGAGCTCAGGTAAGGAAGGGGTGACAAGTGGGGTCTGAGTTTTCTTGTCCCACTGGGGGTT
TCAAGCCCCAGGTAGAAGTGTGCCCTGCCTGGTTACTGGGAAGCACCATCCACACTCATGGGCCTACCCAGCCTGGGCCC
TGTGTGCCAGCACCTTCTCTTTTGTAAAGCACCTGTGACAATGAAGGACAGATTTATCACCTTGATGATTGTAGTGATGG
GGACCTGATCCTAGTAATCACAGGTCAGGGGAAGGTCCCTGGCTAAGGACAGACCTTAGGAGGGCAGTTGGTCGAGGACC
CACATCTGCTTTCCTTGTTTTTCCTGATCCCGCCCTGAGTCTGCAGTCACACATTTCTGGAAACTTCTCGAGGGTCCAAG
ACTAGGAGGTTCCTCTAGGACCTCATGGCCCTGCCACCTTTCTGGCCTCTCACAGGACGTTTTCTTCCCACAGATTGAAA
AGGAGGGAGCTACTCTCAGGCTGCAAGTAAGTATGAAGGAGGCTGATCCCTGAGATCCTTGGGATCTTGTGTTTGGGAGC
CCATGGGGGAGCTCACCCACCCCACAATTCCTCCTCTGGCCACATCTCCTGTGGTCTCTGACCAGGTGCTGTTTTTGTTC
TACTCTAGGCAGTGACAGTGCCCAGGGCTCTAATGTGTCTCTCACGGCTTGTAAATGTGACACCCCGGGGGGCCTGATGT
GTGTGGGTTGTTGAGGGGAACAGTGGACATAGCTGTGCTATGAGGTTTCTTTGACTTG

IMGT/HLA

Sponsors

Animated Sponsors Logo