Allele Report for G*01:01:02:01

G*01:01:02:01 View HGVS Report
Pre-2010 Nomenclature: G*01010201 Local Names: DRB1 T DRB1*1602
IMGT/HLA Acc No: HLA00940 OMIM Entry: *142871
Assigned: 1994-03-03 Sequence Last Modified: 1999-08-06
Source Entries: AB023057 , AF055066 , AL671561 , AY645769 , BX001005 , D67009 , D67010 , D67011 , D85032 , GQ996566 , GQ996569 , L41392 , M32800 , U65245 , U65246 , U88244 , X60983  
Cells Sequence Derived From: 1408-1012 , 1408-1014 , 1408-1038 , BCI-13 , BCI-14 , BCI-19 , BOLETH , BeWo , COX , CUI-80 , DHIF , HT43 , QBL , RPCI5 , STK , TB250 , WT47  
Known Ethnic Origin Of Source: Caucasoid, Oriental
CWD v2.0 Status: Not defined
Publications
Shiina T et al. Proc Natl Acad Sci U S A 96:13282-7 1999. (View abstract)
Traherne JA et al. PLoS Genetics 2:81-92 2006. (View abstract)
Ellis SA et al. J Immunol 144:731-5 1990. (View abstract)
Cervera I et al. Human Immunology 71:1109-1115 2010. (View abstract)
Ober C et al. J Reprod Immunol 32:111-23 1996. (View abstract)
Pyo CW et al. Immunogenetics 58:241-51 2006. (View abstract)
Morales P et al. Immunogenetics 38:323-31 1993. (View abstract)
Yamashita T et al. Tissue Antigens 49:673-4 1997. (View abstract)
Hampe A et al. DNA Seq 10:263-99 1999. (View abstract)
Stewart CA et al. Genome Res 14:1176-87 2004. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 17 Laboratories: 9
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (338 aa)
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEG
PEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAA
DTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILT
WQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAA
VVTGAAVAAVLWRKKSSD
Nucleotide Sequence Data (1017 bps)
ATGGTGGTCATGGCACCCCGAACCCTCTTCCTGCTACTCTCGGGGGCCCTGACCCTGACCGAGACCTGGGCGGGCTCCCA
CTCCATGAGGTATTTCAGCGCCGCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCATGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACTCGGCGTGTCCGAGGATGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCAGAGTATTGGGAAGAGGAGACACGGAACACCAAGGCCCACGCACAGACTGACAGAATGAACCTGCAGACCCTGCGCGG
CTACTACAACCAGAGCGAGGCCAGTTCTCATACCCTCCAGTGGATGATTGGCTGCGACCTGGGGTCCGACGGACGCCTCC
TCCGCGGGTATGAACAGTATGCCTACGATGGCAAGGATTACCTCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCAGCG
GACACTGCGGCTCAGATCTCCAAGCGCAAGTGTGAGGCGGCCAATGTGGCTGAACAAAGGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCACAGATACCTGGAGAACGGGAAGGAGATGCTGCAGCGCGCGGACCCCCCCAAGACACACGTGA
CCCACCACCCTGTCTTTGACTATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCATACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACGTGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAGGAGCAGAGATACACGTGCCATGTGCAGCATGAGGGGCTGCCGGAGCCCC
TCATGCTGAGATGGAAGCAGTCTTCCCTGCCCACCATCCCCATCATGGGTATCGTTGCTGGTCTGGTTGTCCTTGCAGCT
GTAGTCACTGGAGCTGCGGTCGCTGCTGTGCTGTGGAGGAAGAAGAGCTCAGATTGA
Genomic Sequence Data (3138 bps)
TGAGACAGAACGCTTGGCACAAGAGTAGCGGGGTCAGGGCGAAGTCCCAGGGCCTCAAGCGTGGCTCTCAGGGTCTCAGG
CCCCACAGGCGGTGTATGGATTGGGGAGGCCCCGCGTTGGGGATTCTCTCCTCCTTCTCCTAACCTGTGTCGGGTCCTTC
TTCCTGGATACTCACCGGGCGGCCCCAGTTCTCACTCCCATTAGGTGACAGGTTTTTAGAGAAGCCAATCAGCGTCGCCG
CGGTCCTGGTTCTAAAGTCCTCGCTCACCCACCCGGACTCATTCTCCCCAGACGCCAAGGATGGTGGTCATGGCACCCCG
AACCCTCTTCCTGCTACTCTCGGGGGCCCTGACCCTGACCGAGACCTGGGCGGGTGAGTGCGGGGTCAGGAGGGAAACGG
CCCCTGCGCGGAGGAGGGAGGGGCCGGCCCGGCGGGGGCGCAGGACCCGGCAGCCGCGCCGGGAGGAGGGTCGGGCGGGT
CTCAACCTCTCCTCGCCCCCAGGCTCCCACTCCATGAGGTATTTCAGCGCCGCCGTGTCCCGGCCCGGCCGCGGGGAGCC
CCGCTTCATCGCCATGGGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACTCGGCGTGTCCGAGGATGGAGC
CGCGGGCGCCGTGGGTGGAGCAGGAGGGGCCAGAGTATTGGGAAGAGGAGACACGGAACACCAAGGCCCACGCACAGACT
GACAGAATGAACCTGCAGACCCTGCGCGGCTACTACAACCAGAGCGAGGCCAGTGAGTAACCCCGGCCCAGGGCGCAGAT
CACGACCCCCCACCTCCATGCCCCACGGACGCCCCGGGTACTCCCGAGTCTCCGGGTCTGGGATCCACCCCGAGGCCGCG
GGACCCGCCCAGACCCTCTACCTGGGAGAACCCCAGGCGCCTTTACCAAAATCCCTGCGGGTGGGTCCGGGCGAGGGCGA
GGCTCGGTGGGCGGGGCTGACCGAAGGGGTGGGGCCAGGTTCTCATACCCTCCAGTGGATGATTGGCTGCGACCTGGGGT
CCGACGGACGCCTCCTCCGCGGGTATGAACAGTATGCCTACGATGGCAAGGATTACCTCGCCCTGAACGAGGACCTGCGC
TCCTGGACCGCAGCGGACACTGCGGCTCAGATCTCCAAGCGCAAGTGTGAGGCGGCCAATGTGGCTGAACAAAGGAGAGC
CTACCTGGAGGGCACGTGCGTGGAGTGGCTCCACAGATACCTGGAGAACGGGAAGGAGATGCTGCAGCGCGCGGGTACCA
GGGGCAGTGGGGCGCCTCCCTGATCTCCTGTAGACCTCCCAGCCTGGCCTAGCACAAGGAGAGGAGGAAAATGGGACCAA
CACCAGAATATCGCCCTCCCTCTGGTCCTGAGGGAGAGGAATCCTCCTGGGTTTCCAGATCCTGTACCAGAGAGTGATTC
TGAGGGCCCGTCCTGCTCTCTGGGACAATTAAGGGATGAAGTCTCTGAGGGAGTGGAGGGGAAGACAATCCCTGGAGGAC
TGATCAGGGGTTCCCTTTGACCCCACAGCAGCCTTGGCACCAGGACTTTTCCCCTCAGGCCTTGTTCTCTGCCTCACACT
CAATGTGTGTGGGAGTCTGACTCCAGCTCCTCTGAGTCCCTTGGCCTCCACTCAGGTCAGAACCAGAGGTCCCTGCTCCC
CCGCTCAGAGACTAGAACTTTCCAAGGAATAGGAGATTATCCCAGGTGCCCGTGTCCAGGCTGGTGTCTGGGTTCTGTGC
TCCCTTCCCCACCCCAGGTATCTGGTTCATTCTTAGGATGGTCACATCCAGGTGCTGCTGGAGTGTCCCATGAGAGATGC
AAAGTGCTTGAGTTTTCTGACTCTTCCTTTCAGACCCCCCCAAGACACACGTGACCCACCACCCTGTCTTTGACTATGAG
GCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCATACTGACCTGGCAGCGGGATGGGGAGGACCAGAC
CCAGGACGTGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTG
GAGAGGAGCAGAGATACACGTGCCATGTGCAGCATGAGGGGCTGCCGGAGCCCCTCATGCTGAGATGGAGTAAGGAGGGA
GATGGAGGCATCATGTCTGTTAGGGAAAGCAGGAGCCTCTCTGAAGACCTTTAACAGGGTCGGTGGTGAGGCCTGGGGGT
CAGAGACCCTCACCTTCACCTCCTTTCCCAGAGCAGTCTTCCCTGCCCACCATCCCCATCATGGGTATCGTTGCTGGTCT
GGTTGTCCTTGCAGCTGTAGTCACTGGAGCTGCGGTCGCTGCTGTGCTGTGGAGGAAGAAGAGCTCAGGTAAGGAAGGGG
TGACAAGTGGGGTCTGAGTTTTCTTGTCCCACTGGGGGTTTCAAGCCCCAGGTAGAAGTGCGCCCTGCCTGGTTACTGGG
AAGCACCATCCACACTCATGGGCCTACCCAGCCTGGGCCCTGTGTGCCAGCACCTTCTCTTTTGTAAAGCACCTGTGACA
ATGAAGGACAGATTTATCACCTTGATGATTGTAGTGATGGGGACCTGATCCTAGTAATCACAGGTCAGGGGAAGGTCCCT
GGCTAAGGACAGACCTTAGGAGGGCAGTTGGTCGAGGACCCACATCTGCTTTCCTTGTTTTTCCTGATCCCGCCCTGAGT
CTGCAGTCACACATTTCTGGAAACTTCTCGAGGGTCCAAGACTAGGAGGTTCCTCTAGGACCTCATGGCCCTGCCACCTT
TCTGGCCTCTCACAGGACGTTTTCTTCCCACAGATTGAAAAGGAGGGAGCTACTCTCAGGCTGCAAGTAAGTATGAAGGA
GGCTGATCCCTGAGATCCTTGGGATCTTGTGTTTGGGAGCCCATGGGGGAGCTCACCCACCCCACAATTCCTCCTCTGGC
CACATCTCCTGTGGTCTCTGACCAGGTGCTGTTTTTGTTCTACTCTAGGCAGTGACAGTGCCCAGGGCTCTAATGTGTCT
CTCACGGCTTGTAAATGTGACACCCCGGGGGGCCTGATGTGTGTGGGTTGTTGAGGGAAACAGTGGACATAGCTGTGCTA
TGAGGTTTCTTTGACTTG

IMGT/HLA

Sponsors

Animated Sponsors Logo