Allele Report for G*01:01:01:02

G*01:01:01:02 View HGVS Report
Pre-2010 Nomenclature: G*01010102 Local Names: HLA-G*010101Afr-Am022-3
IMGT/HLA Acc No: HLA02283 OMIM Entry: *142871
Assigned: 2005-07-19 Sequence Last Modified: 2005-10-07
Source Entries: AY645762 , GU370776  
Cells Sequence Derived From: CUI-07 , JHUAA0394 , JHUAA0396  
Known Ethnic Origin Of Source: Black, Caucasoid
Publications
Cervera I et al. Human Immunology 71:1109-1115 2010. (View abstract)
Pyo CW et al. Immunogenetics 58:241-51 2006. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (338 aa)
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEG
PEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAA
DTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILT
WQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAA
VVTGAAVAAVLWRKKSSD
Nucleotide Sequence Data (1017 bps)
ATGGTGGTCATGGCGCCCCGAACCCTCTTCCTGCTGCTCTCGGGGGCCCTGACCCTGACCGAGACCTGGGCGGGCTCCCA
CTCCATGAGGTATTTCAGCGCCGCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCATGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACTCGGCGTGTCCGAGGATGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGAAGAGGAGACACGGAACACCAAGGCCCACGCACAGACTGACAGAATGAACCTGCAGACCCTGCGCGG
CTACTACAACCAGAGCGAGGCCAGTTCTCACACCCTCCAGTGGATGATTGGCTGCGACCTGGGGTCCGACGGACGCCTCC
TCCGCGGGTATGAACAGTATGCCTACGATGGCAAGGATTACCTCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCAGCG
GACACTGCGGCTCAGATCTCCAAGCGCAAGTGTGAGGCGGCCAATGTGGCTGAACAAAGGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCACAGATACCTGGAGAACGGGAAGGAGATGCTGCAGCGCGCGGACCCCCCCAAGACACACGTGA
CCCACCACCCTGTCTTTGACTATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCATACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACGTGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAGGAGCAGAGATACACGTGCCATGTGCAGCATGAGGGGCTGCCGGAGCCCC
TCATGCTGAGATGGAAGCAGTCTTCCCTGCCCACCATCCCCATCATGGGTATCGTTGCTGGCCTGGTTGTCCTTGCAGCT
GTAGTCACTGGAGCTGCGGTCGCTGCTGTGCTGTGGAGAAAGAAGAGCTCAGATTGA
Genomic Sequence Data (3138 bps)
TGAGACAGAACGCTTGGCACAAGAGTAGCGGGGTCAGGGCGAAGTCCCAGGGCCTCAAGCGTGGCTCTCAGGGTCTCAGG
CCCCACAGGCGGTGTATGGGTTGGGGAGGCCCCGCGTTGGGGATTCTCTCCTCCTTCTCCTAACCTGTGTCGGGTCCTTC
TTCCTGGATACTCACCGGGCGGCCCCAGTTCTCACTCCCATTAGGTGACAGGTTTTTAGAGAAGCCAATCAGCGTCGCCG
CGGTCCTGGTTCTAAAGTCCTCGCTCACCCACCCGGACTCATTCTCCCCAGACGCCAAGGATGGTGGTCATGGCGCCCCG
AACCCTCTTCCTGCTGCTCTCGGGGGCCCTGACCCTGACCGAGACCTGGGCGGGTGAGTGCGGGGTCAGGAGGGAAACGG
CCCCTGCGCGGAGGAGGGAGGGGCCCGCCTGGCGGGGGCGCAGGACTCGGCAGCCGCGCCGGGAGGAGGGTCGGGCGGGT
CTCAACCCCTCCTCGCCCCCAGGCTCCCACTCCATGAGGTATTTCAGCGCCGCCGTGTCCCGGCCCGGCCGCGGGGAGCC
CCGCTTCATCGCCATGGGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACTCGGCGTGTCCGAGGATGGAGC
CGCGGGCGCCGTGGGTGGAGCAGGAGGGGCCGGAGTATTGGGAAGAGGAGACACGGAACACCAAGGCCCACGCACAGACT
GACAGAATGAACCTGCAGACCCTGCGCGGCTACTACAACCAGAGCGAGGCCAGTGAGTAACTCCGGCCCAGGGAGCAGAT
CACGACCCCCACCTCCATGCCCCACGGACGGCCCGGGTACTCCCGAGTCTCCGGGTCTGGGATCCACCCCGAGGCCGCGG
GACCCGCCCAGACCCTCTACCTGGGAGAACCCCAAGGCGCCTTTACCAAAATCCCCGCGGGTGGGTCCGGGCGAGGGCGA
GGCTCGGTGGGCGGGGCTGACCGAGGGGGTGGGGCCAGGTTCTCACACCCTCCAGTGGATGATTGGCTGCGACCTGGGGT
CCGACGGACGCCTCCTCCGCGGGTATGAACAGTATGCCTACGATGGCAAGGATTACCTCGCCCTGAACGAGGACCTGCGC
TCCTGGACCGCAGCGGACACTGCGGCTCAGATCTCCAAGCGCAAGTGTGAGGCGGCCAATGTGGCTGAACAAAGGAGAGC
CTACCTGGAGGGCACGTGCGTGGAGTGGCTCCACAGATACCTGGAGAACGGGAAGGAGATGCTGCAGCGCGCGGGTACCA
GGGGCAGTGGGGCGCCTCCCTGATCTCCTGTAGACCTCTCAGCCTGGCCTAGCACAAGGAGAGGAGGAAAATGGGACCAA
CACTAGAATATCGCCCTCCCTCTGGTCCTGAGGGAGAGGAATCCTCCTGGGTTTCCAGATCCTGTACCAGAGAGTGATTC
TGAGGGCCCGTCCTGCTCTCTGGGACAATTAAGGGATGAAGTCTCTGAGGGAGTGGAGGGGAAGACAATCCCTGGAAGAC
TGATCAGGGGTTCCCTTTGACCCCACAGCAGCCTTGGCACCAGGACTTTTCCCCTCAGGCCTTGTTCTCTGCCTCACACT
CAATGTGTGTGGGGGTCTGACTCCAGCTCCTCTGAGTCCCTTGGCCTCCACTCAGGTCAGAACCGGAGGTCCCTGCTCCC
CCGCTCAGAGACTAGAACTTTCCAAGGAATAGGAGATTATCCCAGGTGCCCGTGTCCAGGCTGGTGTCTGGGTTCTGTGC
TCCCTTCCCCACCCCAGGTATCTGGTTCATTCTTAGGATGGTCACATCCAGGTGCTGCTGGAGTGTCCCATGAGAGATGC
AAAGTGCTTGAATTTTCTGACTCTTCCTTTCAGACCCCCCCAAGACACACGTGACCCACCACCCTGTCTTTGACTATGAG
GCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCATACTGACCTGGCAGCGGGATGGGGAGGACCAGAC
CCAGGACGTGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTG
GAGAGGAGCAGAGATACACGTGCCATGTGCAGCATGAGGGGCTGCCGGAGCCCCTCATGCTGAGATGGAGTAAGGAGGGA
GATGGAGGCATCATGTCTGTTAGGGAAAGCAGGAGCCTCTCTGAAGACCTTTAACAGGGTCGGTGGTGAGGGCTGGGGGT
CAGAGACCCTCACCTTCACCTCCTTTCCCAGAGCAGTCTTCCCTGCCCACCATCCCCATCATGGGTATCGTTGCTGGCCT
GGTTGTCCTTGCAGCTGTAGTCACTGGAGCTGCGGTCGCTGCTGTGCTGTGGAGAAAGAAGAGCTCAGGTAAGGAAGGGG
TGACAAGTGGGGTCTGAGTTTTCTTGTCCCACTGGGGGTTTCAAGCCCCAGGTAGAAGTGTGCCCTGCCTGGTTACTGGG
AAGCACCATCCACACTCATGGGCCTACCCAGCCTGGGCCCTGTGTGCCAGCACCTTCTCTTTTGTAAAGCACCTGTGACA
ATGAAGGACAGATTTATTACCTTGATGATTGTAGTGATGGGGACCTGATCCCAGTAATCACAGGTCAGGAGAAGGTCCCT
GGCTAAGGACAGACCTTAGGAGGGCAGTTGGTCGAGGACCCACATCTGCTTTCCTTGTTTTTCCTGATCCCGCCCTGGGT
CTGCAGTCACACATTTCTGGAAACTTCTCGAGGGTCCAAGACTAGGAGGTTCCTCTAGGACCTCATGGCCCTGCCACCTT
TCTGGCCTCTCACAGGACATTTTCTTCCCACAGATTGAAAAGGAGGGAGCTACTCTCAGGCTGCAAGTAAGTATGAAGGA
GGCTGATCCCTGAGATCCTTGGGATCTTGTGTTTGGGAGCCCATGGGGGAGCTCACCCACCCCACAATTCCTCCTCTGGC
CACATCTCCTGTGGTCTCTGACCAGGTGCTGTTTTTGTTCTACTCTAGGCAGTGACAGTGCCCAGGGCTCTAATGTGTCT
CTCACGGCTTGTAAATGTGACACCCCGGGGGGCCTGATGTGTGTGGGTTGTTGAGGGGAACAGGGGACATAGCTGTGCTA
TGAGGTTTCTTTGACTTG

IMGT/HLA

Sponsors

Animated Sponsors Logo