Allele Report for G*01:01:01:01

G*01:01:01:01 View HGVS Report
Pre-2010 Nomenclature: G*01010101 Local Names: G*01011, HLA-6.0, G*I, GJ1, GCO1 = G*01011
IMGT/HLA Acc No: HLA00939 OMIM Entry: *142871
Assigned: 1994-03-03 Sequence Last Modified: 1999-08-06
Source Entries: AH005893 , AY645768 , AY645770 , AY645771 , AY645774 , CR759769 , CR788234 , CT009517 , D77998 , D77999 , D78000 , GQ996557 , GQ996563 , J03027 , L27836 , L27837 , U76216 , U76217 , X17273  
Cells Sequence Derived From: 1408-1012 , 1416-1188 , 1416-1194 , 1416-1195 , 1416-1197 , ASR53 , BCI-08 , BCI-09 , BCI-13 , BCI-17 , BCI-18 , CUI-61 , DBB , HAN19-01 , HAN19-05 , HT68 , LCL721 , MLF , MOU , SPO010 , YRK  
Known Ethnic Origin Of Source: Caucasoid, Oriental
CWD v2.0 Status: Not defined
Publications
Cervera I et al. Human Immunology 71:1109-1115 2010. (View abstract)
Ober C et al. J Reprod Immunol 32:111-23 1996. (View abstract)
Pyo CW et al. Immunogenetics 58:241-51 2006. (View abstract)
Yamashita T et al. Immunogenetics 44:186-91 1996. (View abstract)
Geraghty DE et al. Proc Natl Acad Sci U S A 84:9145-9 1987. (View abstract)
Morales P et al. Immunogenetics 38:323-31 1993. (View abstract)
Shukla H et al. Nucleic Acids Res 18:2189-2189 1990. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 21 Laboratories: 8
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (338 aa)
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEG
PEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAA
DTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILT
WQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAA
VVTGAAVAAVLWRKKSSD
Nucleotide Sequence Data (1017 bps)
ATGGTGGTCATGGCGCCCCGAACCCTCTTCCTGCTGCTCTCGGGGGCCCTGACCCTGACCGAGACCTGGGCGGGCTCCCA
CTCCATGAGGTATTTCAGCGCCGCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCATGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACTCGGCGTGTCCGAGGATGGAGCCGCGGGCGCCGTGGGTGGAGCAGGAGGGG
CCGGAGTATTGGGAAGAGGAGACACGGAACACCAAGGCCCACGCACAGACTGACAGAATGAACCTGCAGACCCTGCGCGG
CTACTACAACCAGAGCGAGGCCAGTTCTCACACCCTCCAGTGGATGATTGGCTGCGACCTGGGGTCCGACGGACGCCTCC
TCCGCGGGTATGAACAGTATGCCTACGATGGCAAGGATTACCTCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCAGCG
GACACTGCGGCTCAGATCTCCAAGCGCAAGTGTGAGGCGGCCAATGTGGCTGAACAAAGGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCACAGATACCTGGAGAACGGGAAGGAGATGCTGCAGCGCGCGGACCCCCCCAAGACACACGTGA
CCCACCACCCTGTCTTTGACTATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCATACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACGTGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAGGAGCAGAGATACACGTGCCATGTGCAGCATGAGGGGCTGCCGGAGCCCC
TCATGCTGAGATGGAAGCAGTCTTCCCTGCCCACCATCCCCATCATGGGTATCGTTGCTGGCCTGGTTGTCCTTGCAGCT
GTAGTCACTGGAGCTGCGGTCGCTGCTGTGCTGTGGAGAAAGAAGAGCTCAGATTGA
Genomic Sequence Data (3138 bps)
TGAGACAGAACGCTTGGCACAAGAGTAGCGGGGTCAGGGCGAAGTCCCAGGGCCTCAAGCGTGGCTCTCAGGGTCTCAGG
CCCCACAGGCGGTGTATGGGTTGGGGAGGCCCCGCGTTGGGGATTCTCTCCTCCTTCTCCTAACCTGTGTCGGGTCCTTC
TTCCTGGATACTCACCGGGCGGCCCCAGTTCTCACTCCCATTAGGTGACAGGTTTTTAGAGAAGCCAATCAGCGTCGCCG
CGGTCCTGGTTCTAAAGTCCTCGCTCACCCACCCGGACTCATTCTCCCCAGACGCCAAGGATGGTGGTCATGGCGCCCCG
AACCCTCTTCCTGCTGCTCTCGGGGGCCCTGACCCTGACCGAGACCTGGGCGGGTGAGTGCGGGGTCAGGAGGGAAACGG
CCCCTGCGCGGAGGAGGGAGGGGCCCGCCTGGCGGGGGCGCAGGACTCGGCAGCCGCGCCGGGAGGAGGGTCGGGCGGGT
CTCAACCCCTCCTCGCCCCCAGGCTCCCACTCCATGAGGTATTTCAGCGCCGCCGTGTCCCGGCCCGGCCGCGGGGAGCC
CCGCTTCATCGCCATGGGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACTCGGCGTGTCCGAGGATGGAGC
CGCGGGCGCCGTGGGTGGAGCAGGAGGGGCCGGAGTATTGGGAAGAGGAGACACGGAACACCAAGGCCCACGCACAGACT
GACAGAATGAACCTGCAGACCCTGCGCGGCTACTACAACCAGAGCGAGGCCAGTGAGTAACTCCGGCCCAGGGAGCAGAT
CACGACCCCCACCTCCATGCCCCACGGACGGCCCGGGTACTCCCGAGTCTCCGGGTCTGGGATCCACCCCGAGGCCGCGG
GACCCGCCCAGACCCTCTACCTGGGAGAACCCCAAGGCGCCTTTACCAAAATCCCCGCGGGTGGGTCCGGGCGAGGGCGA
GGCTCGGTGGGCGGGGCTGACCGAGGGGGTGGGGCCAGGTTCTCACACCCTCCAGTGGATGATTGGCTGCGACCTGGGGT
CCGACGGACGCCTCCTCCGCGGGTATGAACAGTATGCCTACGATGGCAAGGATTACCTCGCCCTGAACGAGGACCTGCGC
TCCTGGACCGCAGCGGACACTGCGGCTCAGATCTCCAAGCGCAAGTGTGAGGCGGCCAATGTGGCTGAACAAAGGAGAGC
CTACCTGGAGGGCACGTGCGTGGAGTGGCTCCACAGATACCTGGAGAACGGGAAGGAGATGCTGCAGCGCGCGGGTACCA
GGGGCAGTGGGGCGCCTCCCTGATCTCCTGTAGACCTCTCAGCCTGGCCTAGCACAAGGAGAGGAGGAAAATGGGACCAA
CACTAGAATATCGCCCTCCCTCTGGTCCTGAGGGAGAGGAATCCTCCTGGGTTTCCAGATCCTGTACCAGAGAGTGATTC
TGAGGGCCCGTCCTGCTCTCTGGGACAATTAAGGGATGAAGTCTCTGAGGGAGTGGAGGGGAAGACAATCCCTGGAAGAC
TGATCAGGGGTTCCCTTTGACCCCACAGCAGCCTTGGCACCAGGACTTTTCCCCTCAGGCCTTGTTCTCTGCCTCACACT
CAATGTGTGTGGGGGTCTGACTCCAGCTCCTCTGAGTCCCTTGGCCTCCACTCAGGTCAGAACCGGAGGTCCCTGCTCCC
CCGCTCAGAGACTAGAACTTTCCAAGGAATAGGAGATTATCCCAGGTGCCCGTGTCCAGGCTGGTGTCTGGGTTCTGTGC
TCCCTTCCCCACCCCAGGTATCTGGTTCATTCTTAGGATGGTCACATCCAGGTGCTGCTGGAGTGTCCCATGAGAGATGC
AAAGTGCTTGAATTTTCTGACTCTTCCTTTCAGACCCCCCCAAGACACACGTGACCCACCACCCTGTCTTTGACTATGAG
GCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCATACTGACCTGGCAGCGGGATGGGGAGGACCAGAC
CCAGGACGTGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTG
GAGAGGAGCAGAGATACACGTGCCATGTGCAGCATGAGGGGCTGCCGGAGCCCCTCATGCTGAGATGGAGTAAGGAGGGA
GATGGAGGCATCATGTCTGTTAGGGAAAGCAGGAGCCTCTCTGAAGACCTTTAACAGGGTCGGTGGTGAGGGCTGGGGGT
CAGAGACCCTCACCTTCACCTCCTTTCCCAGAGCAGTCTTCCCTGCCCACCATCCCCATCATGGGTATCGTTGCTGGCCT
GGTTGTCCTTGCAGCTGTAGTCACTGGAGCTGCGGTCGCTGCTGTGCTGTGGAGAAAGAAGAGCTCAGGTAAGGAAGGGG
TGACAAGTGGGGTCTGAGTTTTCTTGTCCCACTGGGGGTTTCAAGCCCCAGGTAGAAGTGTGCCCTGCCTGGTTACTGGG
AAGCACCATCCACACTCATGGGCCTACCCAGCCTGGGCCCTGTGTGCCAGCACCTTCTCTTTTGTAAAGCACCTGTGACA
ATGAAGGACAGATTTATTACCTTGATGATTGTAGTGATGGGGACCTGATCCCAGTAATCACAGGTCAGGAGAAGGTCCCT
GGCTAAGGACAGACCTTAGGAGGGCAGTTGGTCGAGGACCCACATCTGCTTTCCTTGTTTTTCCTGATCCCGCCCTGGGT
CTGCAGTCACACATTTCTGGAAACTTCTCGAGGGTCCAAGACTAGGAGGTTCCTCTAGGACCTCATGGCCCTGCCACCTT
TCTGGCCTCTCACAGGACATTTTCTTCCCACAGATTGAAAAGGAGGGAGCTACTCTCAGGCTGCAAGTAAGTATGAAGGA
GGCTGATCCCTGAGATCCTTGGGATCTTGTGTTTGGGAGCCCATGGGGGAGCTCACCCACCCCACAATTCCTCCTCTGGC
CACATCTCCTGTGGTCTCTGACCAGGTGCTGTTTTTGTTCTACTCTAGGCAGTGACAGTGCCCAGGGCTCTAATGTGTCT
CTCACGGCTTGTAAATGTGACACCCCGGGGGGCCTGATGTGTGTGGGTTGTTGAGGGGAACAGGGGACATAGCTGTGCTA
TGAGGTTTCTTTGACTTC

IMGT/HLA

Sponsors

Animated Sponsors Logo