Allele Report for F*01:02

F*01:02 View HGVS Report
Pre-2010 Nomenclature: F*0102 Local Names: HLA-F*010101Afr-Am024-1
IMGT/HLA Acc No: HLA02267 OMIM Entry: *143110
Assigned: 2005-07-25 Sequence Last Modified: 2005-10-07
Source Entries: AY645747  
Cells Sequence Derived From: JHUAA0527 , JHUAA0529 , JHUAA0530  
Known Ethnic Origin Of Source: Black
Publications
Pyo CW et al. Immunogenetics 58:241-51 2006. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (362 aa)
MAPRSLLLLLSGVLALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQY
WEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTV
AQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQR
DGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVT
GAVVAAVMWRKKSSDRNRGSYSQAAVTDSAQGSGVSLTANKV
Nucleotide Sequence Data (1089 bps)
ATGGCGCCCCGAAGCCTCCTCCTGCTGCTCTCAGGGGTCCTGGCCCTGACCGATACTTGGGCGGGCTCCCACTCCTTGAG
GTATTTCAGCACCGCTGTGTCGCGGCCCGGCCGCGGGGAGCCCCGCTACATCGCCGTGGAGTACGTAGACGACACGCAAT
TCCTGCGGTTCGACAGCGACGCCGCGATTCCGAGGATGGAGCCGCGGGAGCCGTGGGTGGAGCAAGAGGGGCCGCAGTAT
TGGGAGTGGACCACAGGGTACGCCAAGGCCAACGCACAGACTGACCGAGTGGCCCTGAGGAACCTGCTCCGCCGCTACAA
CCAGAGCGAGGCTGGGTCTCACACCCTCCAGGGAATGAATGGCTGCGACATGGGGCCCGACGGACGCCTCCTCCGCGGGT
ATCACCAGCACGCGTACGACGGCAAGGATTACATCTCCCTGAACGAGGACCTGCGCTCCTGGACCGCGGCGGACACCGTG
GCTCAGATCACCCAGCGCTTCTATGAGGCAGAGGAATATGCAGAGGAGTTCAGGACCTACCTGGAGGGCGAGTGCCTGGA
GTTGCTCCGCAGATACTTGGAGAATGGGAAGGAGACGCTACAGCGCGCAGATCCTCCAAAGGCACACGTTGCCCACCACC
CCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACGCTGACCTGGCAGCGG
GATGGGGAGGAACAGACCCAGGACACAGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCCGC
TGTGGTGGTGCCTTCTGGAGAGGAACAGAGATACACATGCCATGTGCAGCACGAGGGGCTGCCCCAGCCCCTCATCCTGA
GATGGGAGCAGTCTCCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTTGTTGTCCTTGGAGCTGTGGTCACT
GGAGCTGTGGTCGCTGCTGTGATGTGGAGGAAGAAGAGCTCAGATAGAAACAGAGGGAGCTACTCTCAGGCTGCAGTCAC
TGACAGTGCTCAGGGCTCTGGGGTGTCTCTCACAGCTAATAAAGTGTGA
Genomic Sequence Data (3543 bps)
GGGAGGGGGAGGGCAAAGTCCCAGGGCCCCAGGAGTGGCTCTCAAGGGCTCAGGCCCCGAGGCGGTGTCTGGGGTTGGGA
GGCTCAGTATTGAGAATTCCCCATCTCCCCAGAGTTTCTCTTTCTCTCCCAACCCGTGTCAGGTCCTTCTTCCTGGATAC
TCATAACGCGGCCCCATTTCTCACTCCCATTGGGCGTCGCGTTTCTAGAGAAGCCAATCAGTGTCGCCGCAGTTCCCAGG
TTCTAAAGTCCCACGCACCCCGCGGGACTCATATTTTTCCCAGACGCGGAGGTTGGGGTCATGGCGCCCCGAAGCCTCCT
CCTGCTGCTCTCAGGGGTCCTGGCCCTGACCGATACTTGGGCGGGTGAGTGCGGGGTCCAGAGAGAAACGGCCTCTGTGG
GGAGGAGTGAGGGGCCCGCCCGGTGGGGGCGCAGGACTCAGGGAGCCGCGCCCGGAGGAGGGTCTGGCGGGTCTCAGCCC
CTCCTCGCCCCCAGGCTCCCACTCCTTGAGGTATTTCAGCACCGCTGTGTCGCGGCCCGGCCGCGGGGAGCCCCGCTACA
TCGCCGTGGAGTACGTAGACGACACGCAATTCCTGCGGTTCGACAGCGACGCCGCGATTCCGAGGATGGAGCCGCGGGAG
CCGTGGGTGGAGCAAGAGGGGCCGCAGTATTGGGAGTGGACCACAGGGTACGCCAAGGCCAACGCACAGACTGACCGAGT
GGCCCTGAGGAACCTGCTCCGCCGCTACAACCAGAGCGAGGCTGGTGAGTGAACCCGGCCGGGGGCGCAGGTCACGACCA
CCCCCCATCCGCCACGGACCGCCCGGGTCCCTCAGAGTCTCCGGATCCGAAATCTACCCCGAGGCAGCGGGACCCGCCCA
GACCCTCCACCCGGGAGAGTCCCAGGCGCCTTTACCCAGGTTCATTTTCAGTTTAGGCCAAAATCCCCGCGGGTTGGGCG
GGGAGGGGGCGGGGCTAGCTGGGCGGGGCTGACTGCGGGGACCGGCTAGGGTCTCACACCCTCCAGGGAATGAATGGCTG
CGACATGGGGCCCGACGGACGCCTCCTCCGCGGGTATCACCAGCACGCGTACGACGGCAAGGATTACATCTCCCTGAACG
AGGACCTGCGCTCCTGGACCGCGGCGGACACCGTGGCTCAGATCACCCAGCGCTTCTATGAGGCAGAGGAATATGCAGAG
GAGTTCAGGACCTACCTGGAGGGCGAGTGCCTGGAGTTGCTCCGCAGATACTTGGAGAATGGGAAGGAGACGCTACAGCG
CGCAGGTACCAGGGGCCATGGGCGCCTTCCCTATCTCCTGTAGATCTCTTGGGATGGCCTCGCACAAGGTTGGGAGGAAA
GTGGGCCCAATGCTAGGATATCGCCCTCCCTCTAGTCCTGAGTAGGAAGAATCTTCCTGGCTTTCGAGATCCGGTACCAG
AGAGTGACTGTGAGAGTCCGCCCTGCTCTCTGGGACAATTAAGGGATGAAATTTCTGAGGGAATGGAGGGAAGACAGTCC
CTGGAATACCGATCCGCGGTCCCCTTTGAGCCCTCCAACAGCCTTGGGCCCCGTGACTTTTCTCTCAAGTTTTGTTCTCT
GCCTCACACTCAATGTGTTTGGGGCTCTGATTCCAGTCCCTCGGCCTCCACTTAGGTCAGGGCCAGAAGTCCCTGCTCCC
CCCTCAGAGACTCGAACTTTCCAAGGAATAGGAGATTTTCCCAGGTGTCTGTGTCCAGGCTGGTGTCTGGGTTCTGTGCT
CCCTTCCCCACCCCAGGTGTCCTGTCCATTCTCAGGTTGGTCACATGGGTGCTGCTGGGGTTTCCCATGAGGAGTGCAAA
GTGCCTGAATTTTCTGACTCTTCTCAGATCCTCCAAAGGCACACGTTGCCCACCACCCCATCTCTGACCATGAGGCCACC
CTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACGCTGACCTGGCAGCGGGATGGGGAGGAACAGACCCAGGA
CACAGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCCGCTGTGGTGGTGCCTTCTGGAGAGG
AACAGAGATACACATGCCATGTGCAGCACGAGGGGCTGCCCCAGCCCCTCATCCTGAGATGGGGTAAGGAGGGAGATGGG
TAAAGAGGGGAACGAGGGGTCATGTCTTTTCTCAGGGAAAGCAGGAGCCCTTCTGGAGCTCTTCAGCAGGGTCAGGGCTG
AGCCTGGAGATCAGGGCCCCTCACCTTCCCTTCCTTTCCCAGAGCAGTCTCCCCAGCCCACCATCCCCATCGTGGGCATC
GTTGCTGGCCTTGTTGTCCTTGGAGCTGTGGTCACTGGAGCTGTGGTCGCTGCTGTGATGTGGAGGAAGAAGAGCTCAGG
TAGGAAGGGGTGAGGAGTGGAGTCTGAGTTTTCTTGTCCCACTGGGGGTTGCAAGCCCCAAGTAGAAGTGTGCCCTGCCT
CATTACTGGGAAGCACCATCCACACTCATGGGTCTACCCAGCCTGGGCCCTGTGTGCCAGCACCTACTCATTTGTAAAGC
TCCTGTGAAAATGAAGGACAGATTCTTCACTTCGATGATTATGGTGGTGATGGGACCTGATCCCAGCAGTCACAAATCAC
AGGGGAAGGTCCCTGCTGATGACAGACCTCAGGAGGGCAGTTGGTCCAGGACCCACATCTGCTTTCTTCATATTTCTTGA
TCCTGCCCTGGATCTACAGTTACACTTTTCTGGAAACTTCTCTGGGATCAAAGACTAGGGGTTTGCTCTAGGACCTTATG
GCCCTGCCTCCTTTCTGGCCTCTCACAGGACATTTTCTTCCCATAGATAGAAACAGAGGGAGCTACTCTCAGGCTGCAGG
TAAGATGAAGGAGGCTGATCCCTGAGATTGTTGGGATATTGTGGTCAGGAGCCTATGAGGGAGCTCACCCACCCCACAGT
TCCTCTAGCCACATCTGTGGGCTCTGACCAGGTCCTGTTTTTGTTCTACCCCAATCACTGACAGTGCTCAGGGCTCTGGG
GTGTCTCTCACAGCTAATAAAGGTGACACTCCAGGGCAGGGGCCCTGATGTGAGTGGGGTGTTGGGGGGGAACAGAGGGG
ACTCAGCTGTGCTATTGGGTTTCTTTGACTTGGATGTCTTGAGCATGAAATGGGCTATTTAGAGTGTTACCTCTCACTGT
GACTGATACGAATTTGTTCATGAATATTTTCTCTATAGTGTGAGACAGCTTCCTTGTGTGGGACTGAGAAGCAAGATATC
AATGTAGCAGAATTGCACTTGTGCCTCACGAACATACATAAATTTTAAAAATAAAGAATAAAAATATATCTTTTTATAGA
TACAGGTAGATATGTTTTTATAGCATGCACGTAAATGTGTGTGTGTGTGTGTGTGAAGAGAAAGAGTGAATAGAGAGATT
AAGATTCTTTTAATGGTGAAAAGATATACATATATTTGGAATTAGCCAGCTTGACTCAGTTTAGGTGATCCCAATTTTGG
TGGCAACAACCAAAGCATCGTAG

IMGT/HLA

Sponsors

Animated Sponsors Logo