Allele Report for F*01:01:03:01

F*01:01:03:01 View HGVS Report
Pre-2010 Nomenclature: F*01010301 Local Names: HLA-F LKT3
IMGT/HLA Acc No: HLA02275 OMIM Entry: *143110
Assigned: 2005-07-25 Sequence Last Modified: 2005-10-07
Source Entries: AB023058 , AB088082 , AF523285 , AF523286 , AF523289 , AL669813  
Cells Sequence Derived From: BM15 , COX , LBF , LKT3 , RPCI5 , STEINLIN  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
Shiina T et al. Proc Natl Acad Sci U S A 96:13282-7 1999. (View abstract)
Pyo CW et al. Immunogenetics 58:241-51 2006. (View abstract)
Stewart CA et al. Genome Res 14:1176-87 2004. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 6 Laboratories: 3
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (362 aa)
MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQY
WEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTV
AQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQR
DGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVT
GAVVAAVMWRKKSSDRNRGSYSQAAVTDSAQGSGVSLTANKV
Nucleotide Sequence Data (1089 bps)
ATGGCGCCCCGAAGCCTCCTCCTGCTGCTCTCAGGGGCCCTGGCCCTGACCGATACTTGGGCGGGCTCCCACTCCTTGAG
GTATTTCAGCACCGCTGTGTCGCGGCCCGGCCGCGGGGAGCCCCGCTACATCGCCGTGGAGTACGTAGACGACACGCAAT
TCCTGCGGTTCGACAGCGACGCCGCGATTCCGAGGATGGAGCCGCGGGAGCCGTGGGTGGAGCAAGAGGGGCCGCAGTAT
TGGGAGTGGACCACAGGGTACGCCAAGGCCAACGCACAGACTGACCGAGTGGCCCTGAGGAACCTGCTCCGCCGCTACAA
CCAGAGCGAGGCTGGGTCTCACACCCTCCAGGGAATGAATGGCTGCGACATGGGGCCCGACGGACGCCTCCTCCGCGGGT
ATCACCAGCACGCGTACGACGGCAAGGATTACATCTCCCTGAACGAGGACCTGCGCTCCTGGACCGCGGCGGACACCGTG
GCTCAGATCACCCAGCGCTTCTATGAGGCAGAGGAATATGCAGAGGAGTTCAGGACCTACCTGGAGGGCGAGTGCCTGGA
GTTGCTCCGCAGATACTTGGAGAATGGGAAGGAGACGCTACAGCGCGCAGATCCTCCAAAGGCACACGTTGCCCACCACC
CCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACGCTGACCTGGCAGCGG
GATGGGGAGGAACAGACCCAGGACACAGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCCGC
TGTGGTGGTGCCTTCTGGAGAGGAACAGAGATACACATGCCATGTGCAGCACGAGGGGCTGCCCCAGCCCCTCATCCTGA
GATGGGAGCAGTCTCCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTTGTTGTCCTTGGAGCTGTGGTCACT
GGAGCTGTGGTCGCTGCTGTGATGTGGAGGAAGAAGAGCTCAGATAGAAACAGAGGGAGCTACTCTCAGGCTGCAGTCAC
TGACAGTGCTCAGGGCTCTGGGGTGTCTCTCACAGCTAATAAAGTGTGA
Genomic Sequence Data (3544 bps)
GGGAGGGGGAGGGCAAAGTCCCAGGGCCCCAGGAGTGGCTCTCAAGGGCTCAGGCCCCGAGGCGGTGTCTGGGGTTGGGA
GGCTCAGTATTGAGAATTCCCCATCTCCCCAGAGTTTCTCTTTCTCTCCCAACCCGTGTCAGGTCCTTCTTCCTGGATAC
TCATAACGCGGCCCCATTTCTCACTCCCATTGGGCGTCGCGTTTCTAGAGAAGCCAATCAGTGTCGCCGCAGTTCCCAGG
TTCTAAAGTCCCACGCACCCCGCGGGACTCATATTTTTCCCAGACGCGGAGGTTGGGGTCATGGCGCCCCGAAGCCTCCT
CCTGCTGCTCTCAGGGGCCCTGGCCCTGACCGATACTTGGGCGGGTGAGTGCGGGGTCCAGAGAGAAACGGCCTCTGTGG
GGAGGAGTGAGGGGCCCGCCCGGTGGGGGCGCAGGACTCAGGGAGCCGCGCCCGGAGGAGGGTCTGGCGGGTCTCAGCCC
CTCCTCGCCCCCAGGCTCCCACTCCTTGAGGTATTTCAGCACCGCTGTGTCGCGGCCCGGCCGCGGGGAGCCCCGCTACA
TCGCCGTGGAGTACGTAGACGACACGCAATTCCTGCGGTTCGACAGCGACGCCGCGATTCCGAGGATGGAGCCGCGGGAG
CCGTGGGTGGAGCAAGAGGGGCCGCAGTATTGGGAGTGGACCACAGGGTACGCCAAGGCCAACGCACAGACTGACCGAGT
GGCCCTGAGGAACCTGCTCCGCCGCTACAACCAGAGCGAGGCTGGTGAGTGAACCCGGCCGGGGGCGCAGGTCACGACCA
CCCCCCATCCGCCACGGACCGCCCGGGTCCCTCAGAGTCTCCGGATCCGAAATCTACCCCGAGGCAGCGGGACCCGCCCA
GACCCTCCACCCGGGAGAGTCCCAGGCGCCTTTACCCAGGTTCATTTTCAGTTTAGGCCAAAATCCCCGCGGGTTGGGCG
GGGAGGGGGCGGGGCTAGCTGGGCGGGGCTGACTGCGGGGACCGGCTAGGGTCTCACACCCTCCAGGGAATGAATGGCTG
CGACATGGGGCCCGACGGACGCCTCCTCCGCGGGTATCACCAGCACGCGTACGACGGCAAGGATTACATCTCCCTGAACG
AGGACCTGCGCTCCTGGACCGCGGCGGACACCGTGGCTCAGATCACCCAGCGCTTCTATGAGGCAGAGGAATATGCAGAG
GAGTTCAGGACCTACCTGGAGGGCGAGTGCCTGGAGTTGCTCCGCAGATACTTGGAGAATGGGAAGGAGACGCTACAGCG
CGCAGGTACCAGGGGCCATGGGCGCCTTCCCTATCTCCTGTAGATCTCTTGGGATGGCCTCGCACAAGGTTGGGAGGAAA
GTGGGCCCAATGCTAGGATATCGCCCTCCCTCTAGTCCTGAGTAGGAAGAATCTTCCTGGCTTTCGAGATCCGGTACCAG
AGAGTGACTGTGAGAGTCCGCCCTGCTCTCTGGGACAATTAAGGGATGAAATCTCTGAGGGAATGGAGGGAAGACAGTCC
CTGGAATACCGATCCGCGGTCCCCTTTGAGCCCTCCAACAGCCTTGGGCCCCGTGACTTTTCTCTCAAGTTTTGTTCTCT
GCCTCACACTCAATGTGTTTGGGGCTCTGATTCCAGTCCCTCGGCCTCCACTTAGGTCAGGGCCAGAAGTCCCTGCTCCC
CCCTCAGAGACTCGAACTTTCCAAGGAATAGGAGATTTTCCCAGGTGTCTGTGTCCAGGCTGGTGTCTGGGTTCTGTGCT
CCCTTCCCCACCCCAGGTGTCCTGTCCATTCTCAGGTTGGTCACATGGGTGCTGCTGGGGTTTCCCATGAGGAGTGCAAA
GTGCCTGAATTTTCTGACTCTTCTCAGATCCTCCAAAGGCACACGTTGCCCACCACCCCATCTCTGACCATGAGGCCACC
CTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACGCTGACCTGGCAGCGGGATGGGGAGGAACAGACCCAGGA
CACAGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCCGCTGTGGTGGTGCCTTCTGGAGAGG
AACAGAGATACACATGCCATGTGCAGCACGAGGGGCTGCCCCAGCCCCTCATCCTGAGATGGGGTAAGGAGGGAGATGGG
TAAAGAGGGGAACGAGGGGTCATGTCTTTTCTCAGGGAAAGCAGGAGCCCTTCTGGAGCTCTTCAGCAGGGTCAGGGCTG
AGGCCTGGAGATCAGGGCCCCTCACCTTCCCTTCCTTTCCCAGAGCAGTCTCCCCAGCCCACCATCCCCATCGTGGGCAT
CGTTGCTGGCCTTGTTGTCCTTGGAGCTGTGGTCACTGGAGCTGTGGTCGCTGCTGTGATGTGGAGGAAGAAGAGCTCAG
GTAGGAAGGGGTGAGGAGTGGAGTCTGAGTTTTCTTGTCCCACTGGGGGTTGCAAGCCCCAAGTAGAAGTGTGCCCTGCC
TCATTACTGGGAAGCACCATCCACACTCATGGGTCTACCCAGCCTGGGCCCTGTGTGCCAGCACCTACTCATTTGTAAAG
CTCCTGTGAAAATGAAGGACAGATTCTTCACTTCGATGATTATGGTGGTGATGGGACCTGATCCCAGCAGTCACAAATCA
CAGGGGAAGGTCCCTGCTGATGACAGACCTCAGGAGGGCAGTTGGTCCAGGACCCACATCTGCTTTCTTCATATTTCTTG
ATCCTGCCCTGGATCTACAGTTACACTTTTCTGGAAACTTCTCTGGGATCAAAGACTAGGGGTTTGCTCTAGGACCTTAT
GGCCCTGCCTCCTTTCTGGCCTCTCACAGGACATTTTCTTCCCATAGATAGAAACAGAGGGAGCTACTCTCAGGCTGCAG
GTAAGATGAAGGAGGCTGATCCCTGAGATTGTTGGGATATTGTGGTCAGGAGCCTATGAGGGAGCTCACCCACCCCACAG
TTCCTCTAGCCACATCTGTGGGCTCTGACCAGGTCCTGTTTTTGTTCTACCCCAATCACTGACAGTGCTCAGGGCTCTGG
GGTGTCTCTCACAGCTAATAAAGGTGACACTCCAGGGCAGGGGCCCTGATGTGAGTGGGGTGTTGGGGGGGAACAGAGGG
GACTCAGCTGTGCTATTGGGTTTCTTTGACTTGGATGTCTTGAGCATGAAATGGGCTATTTAGAGTGTTACCTCTCACTG
TGACTGATACGAATTTGTTCATGAATATTTTCTCTATAGTGTGAGACAGCTTCCTTGTGTGGGACTGAGAAGCAAGATAT
CAATGTAGCAGAATTGCACTTGTGCCTCACGAACATACATAAATTTTAAAAATAAAGAATAAAAATATATCTTTTTATAG
ATACAGGTAGATATGTTTTTATAGCATGCACGTAAATGTGTGTGTGTGTGTGTGTGAAGAGAAAGAGTGAATAGAGAGAT
TAAGATTCTTTTAATGGTGAAAAGATATACATATATTTGGAATTAGCCAGCTTGACTCAGTTTAGGTGATCCCAATTTTG
GTGGCAACAACCAAAGCATCGTAG

IMGT/HLA

Sponsors

Animated Sponsors Logo