Allele Report for F*01:01:02:03

F*01:01:02:03 View HGVS Report
Pre-2010 Nomenclature: F*01010203 Local Names: HLA-F*010102CEPH1416
IMGT/HLA Acc No: HLA02273 OMIM Entry: *143110
Assigned: 2005-07-25 Sequence Last Modified: 2005-10-07
Source Entries: AY645756  
Cells Sequence Derived From: 1416-1188 , 1416-1194  
Known Ethnic Origin Of Source: Caucasoid
Publications
Pyo CW et al. Immunogenetics 58:241-51 2006. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (362 aa)
MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQY
WEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTV
AQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQR
DGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVT
GAVVAAVMWRKKSSDRNRGSYSQAAVTDSAQGSGVSLTANKV
Nucleotide Sequence Data (1089 bps)
ATGGCGCCCCGAAGCCTCCTCCTGCTGCTCTCAGGGGCCCTGGCCCTGACCGATACTTGGGCAGGCTCCCACTCCTTGAG
GTATTTCAGCACCGCTGTGTCGCGGCCCGGCCGCGGGGAGCCCCGCTACATCGCCGTGGAGTACGTAGACGACACGCAAT
TCCTGCGGTTCGACAGCGACGCCGCGATTCCGAGGATGGAGCCGCGGGAGCCGTGGGTGGAGCAAGAGGGGCCGCAGTAT
TGGGAGTGGACCACAGGGTACGCCAAGGCCAACGCACAGACTGACCGAGTGGCCCTGAGGAACCTGCTCCGCCGCTACAA
CCAGAGCGAGGCTGGGTCTCACACCCTCCAGGGAATGAATGGCTGCGACATGGGGCCCGACGGACGCCTCCTCCGCGGGT
ATCACCAGCACGCGTACGACGGCAAGGATTACATCTCCCTGAACGAGGACCTGCGCTCCTGGACCGCGGCGGACACCGTG
GCTCAGATCACCCAGCGCTTCTATGAGGCAGAGGAATATGCAGAGGAGTTCAGGACCTACCTGGAGGGCGAGTGCCTGGA
GTTGCTCCGCAGATACTTGGAGAATGGGAAGGAGACGCTACAGCGCGCAGATCCTCCAAAGGCACACGTTGCCCACCACC
CCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACGCTGACCTGGCAGCGG
GATGGGGAGGAACAGACCCAGGACACAGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCCGC
TGTGGTGGTGCCTTCTGGAGAGGAACAGAGATACACATGCCATGTGCAGCACGAGGGGCTGCCCCAGCCCCTCATCCTGA
GATGGGAGCAGTCTCCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTTGTTGTCCTTGGAGCTGTGGTCACT
GGAGCTGTGGTCGCTGCTGTGATGTGGAGGAAGAAGAGCTCAGATAGAAACAGAGGGAGCTACTCTCAGGCTGCAGTCAC
TGACAGTGCCCAGGGCTCTGGGGTGTCTCTCACAGCTAATAAAGTGTGA
Genomic Sequence Data (3532 bps)
GGGAGGGGGAGGGCAAAGTCCCAGGGCCCCAGGAGTGGCTCTCAAGGGCTCAGGCCCCGAGGCGGTGTCTGGGGTTGGGA
GGCTCAGTATTGAGAATTCCCCATCTCCCCAGAGTTTCTCTTTCTCTCCCAACCCGTGTCAGGTCCTTCTTCCTGGTTAC
TCATAACGCGGCCCCATTTCTCACTCCCATTGGGCGTCGGGTTTCTAGAGAAGCCAATCAGTGTCGCCGCAGTTCCCAGG
TTCTAAAGTCCCACGCACCCCGCGGGACTCATATTTTTCCCAGACGCGGAGGTTGGGGTCATGGCGCCCCGAAGCCTCCT
CCTGCTGCTCTCAGGGGCCCTGGCCCTGACCGATACTTGGGCAGGTGAGTGCGGGGTCCAGAGAGAAACGGCCTCTGTGG
GGAGGAGTGAGGGGCCCGCCCGGTGGGGGCGCAGGACTCAGGGAGCCGCGCCCGGAGGAGGGTCTGGCGGGTCTCAGCCC
CTCCTCGCCCCCAGGCTCCCACTCCTTGAGGTATTTCAGCACCGCTGTGTCGCGGCCCGGCCGCGGGGAGCCCCGCTACA
TCGCCGTGGAGTACGTAGACGACACGCAATTCCTGCGGTTCGACAGCGACGCCGCGATTCCGAGGATGGAGCCGCGGGAG
CCGTGGGTGGAGCAAGAGGGGCCGCAGTATTGGGAGTGGACCACAGGGTACGCCAAGGCCAACGCACAGACTGACCGAGT
GGCCCTGAGGAACCTGCTCCGCCGCTACAACCAGAGCGAGGCTGGTGAGTGACCCCGGCCGGGGGCGCAGGTCACGACCA
CCCGCCATCCGCCACGGACCGCCCGGGTCCCTCAGAGTCTCCGGATCCGAAATCTACCCCGAGGCAGCGGGACCCGCCCA
GACCCTCCACCCGGGAGAGTCCCAGGCGCCTTTACCCAGGTTCATTTTCAGTTTAGGCCAAAATCCCCGCGGGTTGGGCG
GGGAGGGGGCGGGGCTAGCTGGGCGGGGCTGACTGCGGGGACCGGCTAGGGTCTCACACCCTCCAGGGAATGAATGGCTG
CGACATGGGGCCCGACGGACGCCTCCTCCGCGGGTATCACCAGCACGCGTACGACGGCAAGGATTACATCTCCCTGAACG
AGGACCTGCGCTCCTGGACCGCGGCGGACACCGTGGCTCAGATCACCCAGCGCTTCTATGAGGCAGAGGAATATGCAGAG
GAGTTCAGGACCTACCTGGAGGGCGAGTGCCTGGAGTTGCTCCGCAGATACTTGGAGAATGGGAAGGAGACGCTACAGCG
CGCAGGTACCAGGGGCCATGGGCGCCTTCCCTATCTCCTGTAGATCTCTTGGGATGGCCTCGCACAAGGTTGGGAGGAAA
GTGGGCCCAATGCTAGGATATCGCCCTCCCTCTGGTCCTGAGTAGGAAGAATCTTCCTGGCTTTCGAGATCCGGTACCAG
AGAGTGACTGTGAGAGTCCGCCCTGCTCTCTGGGACAATTAAGGGATGAAATGGAGGGAAGACAGTCCCTGGAATACAGA
TCCGCGGTCCCCTTTGAGCCCTCCAACAGCCTTGGGCCCCGTGACTTTTCTCTCAAGTTTTGTTCTCTGCCTCACACTCA
ATGTGTTTGGGGCTCTGATTCCAGTCCCTCGGCCTCCACTTAGGTCAGGGCCAGAAGTCCCTGCTCCCCGCTCAGAGACT
CGAACTTTCCAAGGAATAGGAGATTTTCCCAGGTGTCTGTGTCCAGGCTGGTGTCTGGGTTCTGTGCTCCCTTCCCCACC
CCAGGTGTCCTGTCCAGTCTCAGGTTGGTCACATGGGTGCTGCTGGGGTTTCCCATGAGGAGTGCAAAGTGCCTGAATTT
TCTGACTCTTCTCAGATCCTCCAAAGGCACACGTTGCCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGG
GCCCTGGGCTTCTACCCTGCGGAGATCACGCTGACCTGGCAGCGGGATGGGGAGGAACAGACCCAGGACACAGAGCTTGT
GGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCCGCTGTGGTGGTGCCTTCTGGAGAGGAACAGAGATACA
CATGCCATGTGCAGCACGAGGGGCTGCCCCAGCCCCTCATCCTGAGATGGGGTAAGGAGGGAGATGGGTAAAGAGGGGAA
TGAGGGGTCATGTCTTTTCTCAGGGAAAGCAGGAGCCCTTCTGGAGCTCTTCAGCAGGGTCAGGGCTGAGCCTGGAGATC
AGGGCCCCTCACCTTCCCTTCCTTTCCCAGAGCAGTCTCCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTT
GTTGTCCTTGGAGCTGTGGTCACTGGAGCTGTGGTCGCTGCTGTGATGTGGAGGAAGAAGAGCTCAGGTAGGAAGGGGTG
AGGAGTGGAGTCTGAGTTTTCTTGTCCCACTGGGGGTTGCAAGCCCCAAGTAGAAGTGTGCCCTGCCTCATTACTGGGAA
GCACCATCCACACTTATGGGTCTACCCAGCCTGGGCCCTGTGTGCCAGCACCTACTCATTTGTAAGGCTCCTGTGAAAAT
GAAGGACAGATTCTTCACTTCGATGATTATGGTGGTGATGGGACCTGATCCCAGCAGTCACAAATCACAGGGGAAGGTCC
CTGCTGATGACAGACCTCAGGAGGGCAGTTGGTCCAGGACCCACATCTGCTTTCTTCATATTTCTTGATCCTGCCCTGGA
TCTACAGTTACACTTTTCTGGAAACTTCTCTGGGATCAAAGACTAGGGGTTTGCTCTAGGACCTTATGGCCCTGCCTCCT
TTCTGGCCTCTCACAGGACATTTTCTTCCCATAGATAGAAACAGAGGGAGCTACTCTCAGGCTGCAGGTAAGATGAAGGA
GGCTGATCCCTGAGATTGTTGGGATATTGTGGTCAGGAGCCTATGAGGGAGCTCACCCACCCCACAGTTCCTCTAGCCAC
ATCTGTGGGCTCTGACCAGGTCCTGTTTTTGTTCTACCCCAATCACTGACAGTGCCCAGGGCTCTGGGGTGTCTCTCACA
GCTAATAAAGGTGACACTCCAGGGCAGGGGCCCTGATGTGAGTGGGGTGTTGGGGGGGGAACAGAGGGGACTCAGCTGTG
CTATTGGGTTTCTTTGACTTGGATGTCTTGAGCATGAAATGGGCTATTTAGAGTGTTACCTCTCACTGTGACTGATACGA
ATTTGTTCATGAATATTTTCTCTATAGTGTGAGACAGCTTCCTTGTGTGGGACTGAGAAGCAAGATATCAATGTAGCAGA
ATTGCACTTGTGCCTCACGAACATACATAAATTTTAAAAATAAAGAATAAAAATATATCTTTTTATAGATACAGGTAGAT
ATGTTTTTATAGCATGCACGTAAATGTGTGTGTGTGTGTGTGTGAAGAGAAAGAGTGAATAGAGAGATTAAGATTCTTTT
AATGGTGAAAAGATATACATATATTTGGAATTAGCCAGCTTGACTCAGTTTAGGTGATCCCAATTTTGGTGGCAACAACC
AAAGCATCGTAG

IMGT/HLA

Sponsors

Animated Sponsors Logo