Allele Report for F*01:01:01:05

F*01:01:01:05
Pre-2010 Nomenclature: F*01010105 Local Names: HLA-F*010101Sea-Cau-3
IMGT/HLA Acc No: HLA02274 OMIM Entry: *143110
Assigned: 2005-07-25 Sequence Last Modified: 2005-10-07
Source Entries: AY645759  
Cells Sequence Derived From: HAN19-02 , HAN19-04 , HAN19-05  
Known Ethnic Origin Of Source: Caucasoid
Publications
Pyo CW et al. Immunogenetics 58:241-51 2006. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (362 aa)
MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQY
WEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTV
AQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQR
DGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVT
GAVVAAVMWRKKSSDRNRGSYSQAAVTDSAQGSGVSLTANKV
Nucleotide Sequence Data (1089 bps)
ATGGCGCCCCGAAGCCTCCTCCTGCTGCTCTCAGGGGCCCTGGCCCTGACCGATACTTGGGCGGGCTCCCACTCCTTGAG
GTATTTCAGCACCGCTGTGTCGCGGCCCGGCCGCGGGGAGCCCCGCTACATCGCCGTGGAGTACGTAGACGACACGCAAT
TCCTGCGGTTCGACAGCGACGCCGCGATTCCGAGGATGGAGCCGCGGGAGCCGTGGGTGGAGCAAGAGGGGCCGCAGTAT
TGGGAGTGGACCACAGGGTACGCCAAGGCCAACGCACAGACTGACCGAGTGGCCCTGAGGAACCTGCTCCGCCGCTACAA
CCAGAGCGAGGCTGGGTCTCACACCCTCCAGGGAATGAATGGCTGCGACATGGGGCCCGACGGACGCCTCCTCCGCGGGT
ATCACCAGCACGCGTACGACGGCAAGGATTACATCTCCCTGAACGAGGACCTGCGCTCCTGGACCGCGGCGGACACCGTG
GCTCAGATCACCCAGCGCTTCTATGAGGCAGAGGAATATGCAGAGGAGTTCAGGACCTACCTGGAGGGCGAGTGCCTGGA
GTTGCTCCGCAGATACTTGGAGAATGGGAAGGAGACGCTACAGCGCGCAGATCCTCCAAAGGCACACGTTGCCCACCACC
CCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACGCTGACCTGGCAGCGG
GATGGGGAGGAACAGACCCAGGACACAGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCCGC
TGTGGTGGTGCCTTCTGGAGAGGAACAGAGATACACATGCCATGTGCAGCACGAGGGGCTGCCCCAGCCCCTCATCCTGA
GATGGGAGCAGTCTCCCCAGCCCACCATCCCCATCGTGGGCATCGTTGCTGGCCTTGTTGTCCTTGGAGCTGTGGTCACT
GGAGCTGTGGTCGCTGCTGTGATGTGGAGGAAGAAGAGCTCAGATAGAAACAGAGGGAGCTACTCTCAGGCTGCAGTCAC
TGACAGTGCCCAGGGCTCTGGGGTGTCTCTCACAGCTAATAAAGTGTGA
Genomic Sequence Data (3543 bps)
GGGAGGGGGAGGGCAAAGTCCCAGGGCCCCAGGAGTGGCTCTCAAGGGCTCAGGCCCCGAGGCGGTGTCTGGGGTTGGGA
GGCTCAGTATTGAGAATTCCCCATCTCCCCAGAGTTTCTCTTTCTCTCCCAACCCGTGTCAGGTCCTTCATCCTGGATAC
TCATAACGCGGCCCCATTTCTCACTCCCATTGGGCGTCGCGTTTCTAGAGAAGCCAATCAGTGTCGCCGCAGTTCCCAGG
TTCTAAAGTCCCACGCACCCCGCGGGACTCATATTTTTCCCAGACGCGGAGGTTGGGGTCATGGCGCCCCGAAGCCTCCT
CCTGCTGCTCTCAGGGGCCCTGGCCCTGACCGATACTTGGGCGGGTGAGTGCGGGGTCCAGAGAGAAACGGCCTCTGTGG
GGAGGAGTGAGGGGCCCGCCCGGTGGGGGCGCAGGACTCAGGGAGCCGCGCCCGGAGGAGGGTCTGGCGGGTCTCAGCCC
CTCCTCGCCCCCAGGCTCCCACTCCTTGAGGTATTTCAGCACCGCTGTGTCGCGGCCCGGCCGCGGGGAGCCCCGCTACA
TCGCCGTGGAGTACGTAGACGACACGCAATTCCTGCGGTTCGACAGCGACGCCGCGATTCCGAGGATGGAGCCGCGGGAG
CCGTGGGTGGAGCAAGAGGGGCCGCAGTATTGGGAGTGGACCACAGGGTACGCCAAGGCCAACGCACAGACTGACCGAGT
GGCCCTGAGGAACCTGCTCCGCCGCTACAACCAGAGCGAGGCTGGTGAGTGAACCCGGCCGGGGGCGCAGGTCACGACCA
CCCCCCATCCGCCACGGACCGCCCGGGTCCCCCAGAGTCTCCGGATCCGAAATCTACCCGGAGGCAGCGGGACCCGCCCA
GACCCTCCACCCGGGAGAGTCCCAGGCGCCTTTACCGAGGTTCATTTTCAGTTTAGGCCAAAATCCCCGCGGGTTGGGCG
GGGAGGGGGCGGGGCTAGCTGGGCGGGGCTGACTGCGGGGACCGGCTAGGGTCTCACACCCTCCAGGGAATGAATGGCTG
CGACATGGGGCCCGACGGACGCCTCCTCCGCGGGTATCACCAGCACGCGTACGACGGCAAGGATTACATCTCCCTGAACG
AGGACCTGCGCTCCTGGACCGCGGCGGACACCGTGGCTCAGATCACCCAGCGCTTCTATGAGGCAGAGGAATATGCAGAG
GAGTTCAGGACCTACCTGGAGGGCGAGTGCCTGGAGTTGCTCCGCAGATACTTGGAGAATGGGAAGGAGACGCTACAGCG
CGCAGGTACCAGGGGCCATGGGCGCCTTCCCTATCTCCTGTAGATCTCTTGGGATGGCCTCGCACAAGGTTGGGAGGAAA
GTGGGCCCAATGCTAGGATATCGCCCTCCCTCTAGTCCTGAGTAGGAAGAATCTTCCTGGCTTTCGAGATCCGGTACCAG
AGAGTGACTGTGAGAGTCCGCCCTGCTCTCTGGGACAATTAAGGGATGAAATCTCTGAGGGAATGGAGGGAAGACAGTCC
CTGGAATACCGATCCGCGGTCCCCTTTGAGCCCTCCAACAGCCTTGGGCCCCGTGACTTTTCTCTCAAGTTTTGTTCTCT
GCCTCACACTCAATGTGTTTGGGGCTCTGATTCCAGTCCCTCGGCCTCCACTTAGGTCAGGGCCAGAAGTCCCTGCTCCC
CACTCAGAGACTCGAACTTTCCAAGGAATAGGAGATTTTCCCAGGTGTCTGTGTCCAGGCTGGTGTCTGGGTTCTGTGCT
CCCTTCCCCACCCCAGGTGTCCTGTCCATTCTCAGGTTGGTCACATGGGTGCTGCTGGGGTTTCCCATGAGGAGTGCAAA
GTGCCTGAATTTTCTGACTCTTCTCAGATCCTCCAAAGGCACACGTTGCCCACCACCCCATCTCTGACCATGAGGCCACC
CTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACGCTGACCTGGCAGCGGGATGGGGAGGAACAGACCCAGGA
CACAGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCCGCTGTGGTGGTGCCTTCTGGAGAGG
AACAGAGATACACATGCCATGTGCAGCACGAGGGGCTGCCCCAGCCCCTCATCCTGAGATGGGGTAAGGAGGGAGATGGG
TAAAGAGGGGAACGAGGGGTCATGTCTTTTCTCAGGGAAAGCAGGAGCCCTTCTGGAGCTCTTCAGCAGGGTCAGGGCTG
AGCCTGGAGATCAGGGCCCCTCACCTTCCCTTCCTTTCCCAGAGCAGTCTCCCCAGCCCACCATCCCCATCGTGGGCATC
GTTGCTGGCCTTGTTGTCCTTGGAGCTGTGGTCACTGGAGCTGTGGTCGCTGCTGTGATGTGGAGGAAGAAGAGCTCAGG
TAGGAAGGGGTGAGGAGTGGAGTCTGAGTTTTCTTGTCCCACTGGGGGTTGCAAGCCCCAAGTAGAAGTGTGCCCTGCCT
CATTACTGGGAAGCACCATCCACACTCATGGGTCTACCCAGCCTGGGCCCTGTGTGCCAGCACCTACTCATTTGTAAAGC
TCCTGTGAAAATGAAGGACAGATTCTTCACTTCGATGATTATGGTGGTGATGGGACCTGATCCCAGCAGTCACAAATCAC
AGGGGAAGGTCCCTGCTGATGACAGACCTCAGGAGGGCAGTTGGTCCAGGACCCACATCTGCTTTCTTCATATTTCTTGA
TCCTGCCCTGGATCTACAGTTACACTTTTCTGGAAACTTCTCTGGGATCAAAGACTAGGGGTTTGCTCTAGGACCTTATG
GCCCTGCCTCCTTTCTGGCCTCTCACAGGACATTTTCTTCCCATAGATAGAAACAGAGGGAGCTACTCTCAGGCTGCAGG
TAAGATGAAGGAGGCTGATCCCTGAGATTGTTGGGATATTGTGGTCAGGAGCCTATGAGGGAGCTCACCCACCCCACAGT
TCCTCTAGCCACATCTGTGGGCTCTGACCAGGTCCTGTTTTTGTTCTACCCCAATCACTGACAGTGCCCAGGGCTCTGGG
GTGTCTCTCACAGCTAATAAAGGTGACACTCCAGGGCAGGGGCCCTGATGTGAGTGGGGTGTTGGGGGGGAACAGAGGGG
ACTCAGCTGTGCTATTGGGTTTCTTTGACTTGGATGTCTTGAGCATGAAATGGGCTATTTAGAGTGTTACCTCTCACTGT
GACTGATACGAATTTGTTCATGAATATTTTCTCTATAGTGTGAGACAGCTTCCTTGTGTGGGACTGAGAAGCAAGATATC
AATGTAGCAGAATTGCACTTGTGCCTCACGAACATACATAAATTTTAAAAATAAAGAATAAAAATATATCTTTTTATAGA
TACAGGTAGATATGTTTTTATAGCATGCACGTAAATGTGTGTGTGTGTGTGTGTGAAGAGAAAGAGTGAATAGAGAGATT
AAGATTCTTTTAATGGTGAAAAGATATACATATATTTGGAATTAGCCAGCTTGACTCAGTTTAGGTGATCCCAATTTTGG
TGGCAACAACCAAAGCATCGTAG

IMGT/HLA

Sponsors

Animated Sponsors Logo